BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0306 (420 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061614-1|AAL29162.1| 615|Drosophila melanogaster SD08036p pro... 28 5.8 AE014296-3096|AAF49200.3| 615|Drosophila melanogaster CG3808-PA... 28 5.8 >AY061614-1|AAL29162.1| 615|Drosophila melanogaster SD08036p protein. Length = 615 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 263 NQPRQARNLQGLLRFEWKPQKLKMHQGTRNWDQLMKKDA 379 +Q Q R L+ L ++WK + LK H + D L KK A Sbjct: 106 SQEDQQRALEILNGYKWKGKVLKAHVAKASADPLQKKRA 144 >AE014296-3096|AAF49200.3| 615|Drosophila melanogaster CG3808-PA protein. Length = 615 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 263 NQPRQARNLQGLLRFEWKPQKLKMHQGTRNWDQLMKKDA 379 +Q Q R L+ L ++WK + LK H + D L KK A Sbjct: 106 SQEDQQRALEILNGYKWKGKVLKAHVAKASADPLQKKRA 144 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,528,508 Number of Sequences: 53049 Number of extensions: 297462 Number of successful extensions: 789 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1271883306 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -