BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0294 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.4 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 7.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 401 SVNITMYRYKTLIDYFIRSNHCYINIPF 318 SVN M+ + + +F + HCY I F Sbjct: 404 SVNAGMWMWLSCSSFFQQFFHCYCPIKF 431 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.4 bits (43), Expect = 7.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 251 STGSHLIQNNVIALTIHAKILNKMGY*YNSDW 346 ++GS I +V AL+ + I+N M Y W Sbjct: 182 ASGSVDISYDVPALSKYLDIINVMAYDLRGSW 213 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 546 SIGIQNTFENGHV 584 SI ++ FENGHV Sbjct: 1513 SIPAKDVFENGHV 1525 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 546 SIGIQNTFENGHV 584 SI ++ FENGHV Sbjct: 1513 SIPAKDVFENGHV 1525 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 546 SIGIQNTFENGHV 584 SI ++ FENGHV Sbjct: 1513 SIPAKDVFENGHV 1525 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 546 SIGIQNTFENGHV 584 SI ++ FENGHV Sbjct: 1513 SIPAKDVFENGHV 1525 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,909 Number of Sequences: 336 Number of extensions: 3032 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -