BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0294 (700 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4.01 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Ma... 25 7.9 SPAC9G1.02 |wis4|wak1, wik1|MAP kinase kinase kinase Wis4|Schizo... 25 7.9 SPBP4H10.20 |nhm1|DcpS|m7G|Schizosaccharomyces pombe|chr 2|||Manual 25 7.9 >SPBC4.01 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 248 Score = 25.4 bits (53), Expect = 7.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 521 LYITLTLTFYWNPEYVRKWS 580 L I LT+ Y P Y+R+WS Sbjct: 124 LSIVLTILKYLAPAYIRQWS 143 >SPAC9G1.02 |wis4|wak1, wik1|MAP kinase kinase kinase Wis4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1401 Score = 25.4 bits (53), Expect = 7.9 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -1 Query: 244 LKLSVLCHRLSSTIL*CI 191 ++LS LC R+SST++ C+ Sbjct: 809 IRLSKLCMRISSTVVDCV 826 >SPBP4H10.20 |nhm1|DcpS|m7G|Schizosaccharomyces pombe|chr 2|||Manual Length = 304 Score = 25.4 bits (53), Expect = 7.9 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -3 Query: 572 FERIL-DSNRTSMLKLYIGQIRNEISGNIIAK 480 FE+IL D ++ ++ LY G+IRNE++ ++ K Sbjct: 17 FEKILKDDTKSKIITLY-GKIRNEVALLLLEK 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,597,260 Number of Sequences: 5004 Number of extensions: 49893 Number of successful extensions: 86 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -