BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0290 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC105.03c |||transcription factor |Schizosaccharomyces pombe|c... 27 3.5 SPAC22A12.10 |||diacylglycerol cholinephosphotranferase/ diacylg... 26 4.7 SPAC23H3.04 |||conserved fungal protein|Schizosaccharomyces pomb... 25 8.2 >SPAC105.03c |||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 708 Score = 26.6 bits (56), Expect = 3.5 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 209 EFVYLIINRYLIVMYLYHFYNSNNQSTIFSIVS 307 +F + I++ +I MYL +N N +T F ++S Sbjct: 618 QFYFCILSSAIIKMYLDFEFNENFNATTFGLLS 650 >SPAC22A12.10 |||diacylglycerol cholinephosphotranferase/ diacylglycerol ethanolaminesphotranferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 386 Score = 26.2 bits (55), Expect = 4.7 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = +2 Query: 218 YLIINRYLIVMYLYHFYNSNNQSTIFSIVSMEHFFYVSIIKCCANPATSTRVTDPLRYTF 397 +++IN +++Y YH+ S +++ ++ F Y S + A T + PL F Sbjct: 57 FVVINILTMLVYKYHYEMDAFPSWVYASWAIGLFLYQSFDAIDGSQARRTGTSSPLGQLF 116 >SPAC23H3.04 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 25.4 bits (53), Expect = 8.2 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 206 IEFVYLIINRYLIVMYLYHFYNSNNQSTIFSIVSMEHFFYV 328 +EFV I+ L V+ L +NS + +F +++++ FFYV Sbjct: 198 VEFVLTILVLPLTVLILTLSFNSVSSENMFLMMTVQ-FFYV 237 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,208,046 Number of Sequences: 5004 Number of extensions: 39091 Number of successful extensions: 77 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -