BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0290 (717 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M20705-1|AAA70215.1| 112|Drosophila melanogaster unknown protei... 35 0.13 AE014298-886|AAF46162.1| 833|Drosophila melanogaster CG3869-PA,... 30 2.7 >M20705-1|AAA70215.1| 112|Drosophila melanogaster unknown protein protein. Length = 112 Score = 34.7 bits (76), Expect = 0.13 Identities = 12/38 (31%), Positives = 25/38 (65%) Frame = +2 Query: 158 QQHKIYLKLHGIICM*IEFVYLIINRYLIVMYLYHFYN 271 +QH+ YL+LH ++ I + +++ R+L+++ LY N Sbjct: 21 RQHRNYLRLHLLVLSFIVLIAIVVARFLLILLLYRLQN 58 >AE014298-886|AAF46162.1| 833|Drosophila melanogaster CG3869-PA, isoform A protein. Length = 833 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = +2 Query: 275 NNQSTI----FSIVSMEHFFYVSIIKCCANPATSTRVTDPLRYT 394 N QS+I +SIV + H +Y+S I+ + + ST T P+ T Sbjct: 615 NRQSSIGVSFYSIVVLHHLYYISAIESRSQHSVSTPTTTPVEAT 658 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,762,994 Number of Sequences: 53049 Number of extensions: 352189 Number of successful extensions: 569 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 568 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3190721655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -