BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0290 (717 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81551-1|CAB04483.2| 335|Caenorhabditis elegans Hypothetical pr... 31 1.1 U50300-7|AAC48106.1| 645|Caenorhabditis elegans Hypothetical pr... 30 1.9 >Z81551-1|CAB04483.2| 335|Caenorhabditis elegans Hypothetical protein F56A12.1 protein. Length = 335 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 239 LIVMYLYHFYNSNNQSTIFSIVSMEHF 319 +IV Y Y Y+SN T+F ++S HF Sbjct: 142 IIVAYTYALYHSNEFETLFHLLSNRHF 168 >U50300-7|AAC48106.1| 645|Caenorhabditis elegans Hypothetical protein R03H4.5 protein. Length = 645 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +2 Query: 167 KIYLKLHGIICM*IEFVYLIINRYLIVMYLYH-FYNSNNQSTIFSIVSMEHFFYVSI 334 K YLKL + F+++ N YL YH F+ N S I I++ H Y + Sbjct: 335 KQYLKLEMRAVFPLVFLFIAANAYLQYSVRYHTFWKYNYTSEIQEIINQNHKSYAPL 391 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,866,529 Number of Sequences: 27780 Number of extensions: 209082 Number of successful extensions: 466 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -