BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0286 (738 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38717| Best HMM Match : Cornifin (HMM E-Value=7.2) 29 3.9 SB_35845| Best HMM Match : ShTK (HMM E-Value=7.9e-14) 29 5.2 >SB_38717| Best HMM Match : Cornifin (HMM E-Value=7.2) Length = 318 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -2 Query: 578 SGLALPLALLKSMGDGNHSPLGGPYARLPT 489 SG+ PLA S D H P+GGP A PT Sbjct: 33 SGIFSPLASSTSASDSRHRPVGGP-AYSPT 61 >SB_35845| Best HMM Match : ShTK (HMM E-Value=7.9e-14) Length = 330 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 478 FIALVGRRAYGPPNGEWL-PSPMDFSNARGRAKPLRTVEYSPQASFEEG 621 F+ + R+ P +WL P +DFS+ RG + P E +EG Sbjct: 28 FLHMPPRKKLHPLGSQWLNPHQLDFSDLRGVSPPTNESEAEVSPGDDEG 76 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,803,490 Number of Sequences: 59808 Number of extensions: 411594 Number of successful extensions: 1125 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1115 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -