BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0286 (738 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC033687-1|AAH33687.1| 304|Homo sapiens mitochondrial methionyl... 30 10.0 BC016630-1|AAH16630.2| 304|Homo sapiens mitochondrial methionyl... 30 10.0 AK055688-1|BAB70984.1| 304|Homo sapiens protein ( Homo sapiens ... 30 10.0 >BC033687-1|AAH33687.1| 304|Homo sapiens mitochondrial methionyl-tRNA formyltransferase protein. Length = 304 Score = 29.9 bits (64), Expect = 10.0 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 Query: 506 TAHLMVSGYRRPWTSAMPGAEPSRCVPLSTLHKPRLKKDK 625 TA +GY PW A+PS+C TL P KK K Sbjct: 256 TATDFYNGYLHPWYQKNSQAQPSQC-RFQTLRLPTKKKQK 294 >BC016630-1|AAH16630.2| 304|Homo sapiens mitochondrial methionyl-tRNA formyltransferase protein. Length = 304 Score = 29.9 bits (64), Expect = 10.0 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 Query: 506 TAHLMVSGYRRPWTSAMPGAEPSRCVPLSTLHKPRLKKDK 625 TA +GY PW A+PS+C TL P KK K Sbjct: 256 TATDFYNGYLHPWYQKNSQAQPSQC-RFQTLRLPTKKKQK 294 >AK055688-1|BAB70984.1| 304|Homo sapiens protein ( Homo sapiens cDNA FLJ31126 fis, clone IMR322000838, highly similar to METHIONYL-TRNA FORMYLTRANSFERASE, MITOCHONDRIAL PRECURSOR (EC ). Length = 304 Score = 29.9 bits (64), Expect = 10.0 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 Query: 506 TAHLMVSGYRRPWTSAMPGAEPSRCVPLSTLHKPRLKKDK 625 TA +GY PW A+PS+C TL P KK K Sbjct: 256 TATDFYNGYLHPWYQKNSQAQPSQC-RFQTLRLPTKKKQK 294 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,634,049 Number of Sequences: 237096 Number of extensions: 1953002 Number of successful extensions: 3847 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3841 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8791154398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -