BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0280 (637 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0106 + 702504-702687,702856-703037,703070-703933 29 2.3 11_06_0723 - 26688378-26688385,26689351-26689569,26690100-266901... 28 5.4 >05_01_0106 + 702504-702687,702856-703037,703070-703933 Length = 409 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 230 LFLTSGFDEGITLKCDN*IRSENVTQSYYTA*WIT*TVC 346 LF T G D +TLK D +E++ + +Y W+ T+C Sbjct: 88 LFKTVGIDRIVTLKQDY---NEDLIRQFYATVWVAETIC 123 >11_06_0723 - 26688378-26688385,26689351-26689569,26690100-26690106, 26690194-26690256,26690329-26690400,26690507-26691681, 26692024-26692626,26692643-26692781 Length = 761 Score = 28.3 bits (60), Expect = 5.4 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -2 Query: 192 ASVDFYEADSMFLTSALTLFIHND*YRPKVSLATFIYLMETIKPQSKKK-TLNEPARVR 19 A V+FY D F S LTL HN P S A + + + Q+K++ LN+ AR+R Sbjct: 112 AKVNFYLHDEKFCISTLTL-DHNHVVSP--SKARHLRCHKKLDLQAKRRLELNDQARIR 167 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,497,500 Number of Sequences: 37544 Number of extensions: 225816 Number of successful extensions: 373 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -