BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0277 (646 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) 285 2e-77 SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) 99 4e-21 SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 2e-14 SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) 73 2e-13 SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) 73 2e-13 SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) 71 8e-13 SB_14773| Best HMM Match : Pkinase (HMM E-Value=1.1e-05) 69 4e-12 SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) 64 9e-11 SB_25257| Best HMM Match : Pkinase (HMM E-Value=4e-10) 64 9e-11 SB_53116| Best HMM Match : Pkinase (HMM E-Value=1.9e-09) 55 4e-08 SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) 55 4e-08 SB_27803| Best HMM Match : Pkinase (HMM E-Value=2.1e-08) 54 8e-08 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50401| Best HMM Match : Pkinase (HMM E-Value=1.7e-16) 44 1e-04 SB_12990| Best HMM Match : PSI (HMM E-Value=6) 44 1e-04 SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) 41 0.001 SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_57804| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) 39 0.004 SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.005 SB_18360| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) 38 0.007 SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.009 SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) 37 0.012 SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_26666| Best HMM Match : Pkinase (HMM E-Value=3.7e-38) 37 0.016 SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.021 SB_29639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) 35 0.049 SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.049 SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.065 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 35 0.065 SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.086 SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.086 SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) 34 0.11 SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_12642| Best HMM Match : Pkinase (HMM E-Value=5.3e-07) 33 0.20 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.26 SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) 32 0.35 SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) 32 0.35 SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) 32 0.46 SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) 32 0.46 SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_50904| Best HMM Match : NACHT (HMM E-Value=2.3e-05) 31 0.61 SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 31 0.80 SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) 31 0.80 SB_1987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_1344| Best HMM Match : HGTP_anticodon (HMM E-Value=4.4) 31 0.80 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 31 0.80 SB_42409| Best HMM Match : Pkinase (HMM E-Value=6.7e-24) 31 1.1 SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_23302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 30 1.9 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) 30 1.9 SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_29500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_22883| Best HMM Match : Pkinase (HMM E-Value=6.4e-12) 29 2.4 SB_10993| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-38) 29 2.4 SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) 29 2.4 SB_23137| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 2.4 SB_55159| Best HMM Match : Ribosomal_S17e (HMM E-Value=2.8) 29 3.2 SB_20165| Best HMM Match : Pkinase (HMM E-Value=0.00013) 29 3.2 SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) 29 3.2 SB_40177| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 4.3 SB_19325| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_14578| Best HMM Match : Gal_Lectin (HMM E-Value=0.72) 29 4.3 SB_56450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_7684| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56801| Best HMM Match : T-box (HMM E-Value=0) 28 5.7 SB_42678| Best HMM Match : Helicase_C (HMM E-Value=1.4e-24) 28 5.7 SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) 28 5.7 SB_3529| Best HMM Match : T-box (HMM E-Value=0) 28 5.7 SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_7401| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_4916| Best HMM Match : PspA_IM30 (HMM E-Value=3.7) 27 9.9 SB_55996| Best HMM Match : DUF1694 (HMM E-Value=6.9) 27 9.9 SB_51460| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-33) 27 9.9 SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_36284| Best HMM Match : Pkinase (HMM E-Value=0.41) 27 9.9 SB_36067| Best HMM Match : Pkinase (HMM E-Value=0.073) 27 9.9 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 27 9.9 >SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 285 bits (699), Expect = 2e-77 Identities = 127/163 (77%), Positives = 143/163 (87%) Frame = +2 Query: 2 SYICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLG 181 SYICSRYYRAPELIFGATDY+ IDVWSAGCV+AELLLGQPIFPGDSGVDQLVEIIKVLG Sbjct: 221 SYICSRYYRAPELIFGATDYSPDIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLG 280 Query: 182 TPTREQIREMNPNYTEFKFPQIKSHPWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQA 361 TPTREQI+EMNP+YTEFKFPQIK HPW KVFR TPP++I+L SRLLEYTP RL+ +++ Sbjct: 281 TPTREQIKEMNPHYTEFKFPQIKPHPWNKVFRPKTPPESINLCSRLLEYTPSGRLNAIES 340 Query: 362 CVHSFFDELREPTARLPNGRPLPPLFNFTEYELGIQPSLNEFL 490 C H FFDELR+P +LPNGR LPPLFNFT EL ++P+LN L Sbjct: 341 CAHCFFDELRDPNTKLPNGRDLPPLFNFTPQELSVKPALNTIL 383 >SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) Length = 870 Score = 98.7 bits (235), Expect = 4e-21 Identities = 48/128 (37%), Positives = 73/128 (57%), Gaps = 3/128 (2%) Frame = +2 Query: 5 YICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGT 184 Y+ +R+YRAPEL+ G T Y +DVW+ GC++AE+L G+P+FPGDS +DQL I++ G Sbjct: 106 YVATRWYRAPELLVGDTKYGRAVDVWAVGCLLAEMLTGEPLFPGDSDIDQLYHIMRCFGN 165 Query: 185 --PTREQIREMNPNYTEFKFPQIKS-HPWAKVFRACTPPDAISLVSRLLEYTPGARLSPL 355 +I + NP + + P IK P + F +P A+ ++ L+ P R + Sbjct: 166 LISRHREIFQKNPLFVGMRLPDIKEVEPMERRFPRISPM-AVDMLKLCLKMDPSERPTCA 224 Query: 356 QACVHSFF 379 Q H FF Sbjct: 225 QLLNHDFF 232 >SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 83.8 bits (198), Expect = 1e-16 Identities = 49/144 (34%), Positives = 75/144 (52%), Gaps = 2/144 (1%) Frame = +2 Query: 8 ICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTP 187 + + +YRAPE++ G Y+ IDVWS G + AE++ +P+F GDS +DQL I ++LGTP Sbjct: 270 VVTLWYRAPEVLLGGQRYSCPIDVWSIGTIFAEMVTKRPLFHGDSEIDQLFRIFRILGTP 329 Query: 188 TREQIREMN--PNYTEFKFPQIKSHPWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQA 361 T E + + P+Y FP+ K D + L+ + L Y P R+S + Sbjct: 330 TEETWKGVTSLPDYKP-TFPKWAGDGLKKAVPQ-LDSDGLDLLKKTLIYDPALRISAKTS 387 Query: 362 CVHSFFDELREPTARLPNGRPLPP 433 H +F L +P + N P P Sbjct: 388 LKHPYF--LNDPKFDI-NSLPKTP 408 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 76.2 bits (179), Expect = 2e-14 Identities = 28/61 (45%), Positives = 47/61 (77%) Frame = +2 Query: 5 YICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGT 184 Y+ +R+YRAPE++ +T+Y++ ID+W+ GC++AEL +P+FPG S VD++ ++ VLG Sbjct: 125 YVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAELYTLRPLFPGSSEVDEIFKVCSVLGP 184 Query: 185 P 187 P Sbjct: 185 P 185 >SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) Length = 492 Score = 73.3 bits (172), Expect = 2e-13 Identities = 38/122 (31%), Positives = 68/122 (55%), Gaps = 3/122 (2%) Frame = +2 Query: 20 YYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 199 +Y+APEL +T Y+ ID+W AGCV AE+LLG+P+F G ++QL I+ + ++ Sbjct: 192 WYKAPELFLNSTGYSNAIDIWGAGCVFAEMLLGKPLFEGRHDIEQLQLILDTIPVDSKGL 251 Query: 200 IR---EMNPNYTEFKFPQIKSHPWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQACVH 370 +M N+ + K ++K F+ P A+ L+ ++L ++P +R++ A H Sbjct: 252 NNLEFDMKANFDKMLLDGPKEPLYSK-FQD-LDPKALDLLKQMLRFSPESRITAEDALTH 309 Query: 371 SF 376 + Sbjct: 310 PY 311 >SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) Length = 279 Score = 73.3 bits (172), Expect = 2e-13 Identities = 44/104 (42%), Positives = 60/104 (57%) Frame = +2 Query: 2 SYICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLG 181 +YI SR+YRAPE+I GA Y ID+WS GC++AELL G P+FPG+ DQL +++LG Sbjct: 54 TYIQSRFYRAPEVILGAR-YGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLG 112 Query: 182 TPTREQIREMNPNYTEFKFPQIKSHPWAKVFRACTPPDAISLVS 313 E++RE + F I S + + T PD VS Sbjct: 113 Y-IPEKLRETSKRAKNF----INSKGYPRYCTITTLPDGSVAVS 151 >SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) Length = 380 Score = 70.9 bits (166), Expect = 8e-13 Identities = 39/128 (30%), Positives = 69/128 (53%), Gaps = 2/128 (1%) Frame = +2 Query: 8 ICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTP 187 + + +YR+PEL+ GA +TT +D+W+ GC+ ELL +P+ G S ++QL I+ +LGTP Sbjct: 196 VVTLWYRSPELLLGAKVHTTAVDMWAVGCIFGELLGNKPLLAGKSEINQLQLIVDLLGTP 255 Query: 188 TREQIREMNPNYTEFKFPQIKSHPWAKVFR--ACTPPDAISLVSRLLEYTPGARLSPLQA 361 + I + K +K P+ + + +SL++ +L Y P R + ++ Sbjct: 256 -NDHIWPGYSSLPGVKSISLKHQPYNNLKHKFSWVSQAGLSLLNYMLMYDPCKRATAAES 314 Query: 362 CVHSFFDE 385 S+F E Sbjct: 315 LQSSYFVE 322 >SB_14773| Best HMM Match : Pkinase (HMM E-Value=1.1e-05) Length = 194 Score = 68.5 bits (160), Expect = 4e-12 Identities = 41/141 (29%), Positives = 68/141 (48%) Frame = +2 Query: 8 ICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTP 187 + +R+YRAPEL++GA Y +D+W+ GC+ ELL P+FPG + + Sbjct: 38 VATRWYRAPELLYGARKYDEGVDLWAVGCIFGELLNNSPLFPGMTDL------------- 84 Query: 188 TREQIREMNPNYTEFKFPQIKSHPWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQACV 367 P+Y + FP + + P K+ + P+A+ L+ R L Y R+ +A + Sbjct: 85 ---------PDYNKITFPDMPAIPLEKIVPDAS-PEAMDLLKRFLVYPSKKRIPASEALL 134 Query: 368 HSFFDELREPTARLPNGRPLP 430 H +F EP + P+P Sbjct: 135 HPYF--FMEPLPAHHSELPIP 153 >SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) Length = 948 Score = 64.1 bits (149), Expect = 9e-11 Identities = 46/140 (32%), Positives = 71/140 (50%), Gaps = 4/140 (2%) Frame = +2 Query: 5 YICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGT 184 Y+ +R+YRAPEL+ +Y+ ID+WS GC++AE++ +P+FPG + ++QL Sbjct: 189 YVATRWYRAPELMLSLNEYSEAIDMWSVGCILAEMIGRRPLFPGANYLNQL--------- 239 Query: 185 PTREQIREMNPNYTEFKFPQIKSHPWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQAC 364 +P E FP KSH P+AI+L+S++L+ P R++ A Sbjct: 240 --------QDPVPFEKFFP--KSH-----------PEAINLLSQMLQLDPKERITVENAL 278 Query: 365 VHSFFDELR----EPTARLP 412 H F E EPT P Sbjct: 279 QHPFLKEYHSEEDEPTCYSP 298 >SB_25257| Best HMM Match : Pkinase (HMM E-Value=4e-10) Length = 892 Score = 64.1 bits (149), Expect = 9e-11 Identities = 27/64 (42%), Positives = 46/64 (71%) Frame = +2 Query: 5 YICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGT 184 YI SR+YR+PE++ G Y ID+WS GC++ E+ G+P+F SG +++++I++VLG Sbjct: 493 YIQSRFYRSPEVLLGIP-YNLAIDMWSLGCILVEMHTGEPLF---SGANEMMKIVEVLGM 548 Query: 185 PTRE 196 P ++ Sbjct: 549 PPKD 552 >SB_53116| Best HMM Match : Pkinase (HMM E-Value=1.9e-09) Length = 481 Score = 55.2 bits (127), Expect = 4e-08 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 20 YYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIF 130 +YRAPEL+ GA YT ID+W+ GC+ AELL +PIF Sbjct: 93 WYRAPELLLGARHYTKAIDIWAIGCIFAELLTCEPIF 129 >SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) Length = 226 Score = 55.2 bits (127), Expect = 4e-08 Identities = 23/55 (41%), Positives = 38/55 (69%) Frame = +2 Query: 2 SYICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEI 166 S + + +YRAPE++ ++ Y T +D+WS C++AEL +P+F G + VDQL +I Sbjct: 171 SVVVTLWYRAPEVLLQSS-YATSVDIWSVACILAELFNRRPLFEGKNDVDQLDKI 224 >SB_27803| Best HMM Match : Pkinase (HMM E-Value=2.1e-08) Length = 318 Score = 54.4 bits (125), Expect = 8e-08 Identities = 32/93 (34%), Positives = 47/93 (50%), Gaps = 2/93 (2%) Frame = +2 Query: 122 PIFPGDSGVDQLVEIIKVLGTPTREQIREM--NPNYTEFKFPQIKSHPWAKVFRACTPPD 295 P+FPG + VDQ+ +I VLGTP +++ + + FPQ K K+ + Sbjct: 104 PLFPGSNEVDQIAKIHDVLGTPVPSILQKFKNKSRHMNYNFPQKKGTGINKLLPHASNM- 162 Query: 296 AISLVSRLLEYTPGARLSPLQACVHSFFDELRE 394 I L+ L Y P R+S QA H +F +LRE Sbjct: 163 CIELIELLCTYDPDERISAKQALRHEYFRDLRE 195 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +2 Query: 8 ICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSG 145 + + +YRAPE++ G+ Y T +DVWS GC+ AE+ I P G Sbjct: 129 VVTLWYRAPEILLGSRYYATPVDVWSIGCIFAEMYTEHWIGPPSYG 174 >SB_50401| Best HMM Match : Pkinase (HMM E-Value=1.7e-16) Length = 535 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQ-PIFPGDSGVDQLVEIIKVLGT 184 +R+PE++ D TT +D+WSAG V L G+ P F + L +II ++G+ Sbjct: 266 FRSPEVLLKCPDQTTAVDIWSAGIVFLCALSGRYPFFRAQDDMTALAQIISLIGS 320 >SB_12990| Best HMM Match : PSI (HMM E-Value=6) Length = 270 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQ-PIFPGDSGVDQLVEIIKVLGT 184 +R+PE++ D TT +D+WSAG V L G+ P F + L +II ++G+ Sbjct: 25 FRSPEVLLKCPDQTTAVDIWSAGIVFLCALSGRYPFFRAQDDMTALAQIISLIGS 79 >SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) Length = 490 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/77 (28%), Positives = 42/77 (54%) Frame = +2 Query: 2 SYICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLG 181 S + + Y+ APE+I Y T++D+WS G +V E++ G+P + + + Q + ++ L Sbjct: 371 SLVGTPYWMAPEVI-SRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPL-QAMRKLRDLE 428 Query: 182 TPTREQIREMNPNYTEF 232 PT +++P F Sbjct: 429 PPTSRNPIQISPRLQSF 445 >SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1378 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/71 (28%), Positives = 39/71 (54%) Frame = +2 Query: 20 YYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ 199 Y+ APE++ Y ++DVWS G + E++ G+P + ++ + L +I GTP Sbjct: 381 YWMAPEVVT-RKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALY-LIATNGTPELAH 438 Query: 200 IREMNPNYTEF 232 +++P + +F Sbjct: 439 PEKLSPVFKDF 449 >SB_57804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 39.5 bits (88), Expect = 0.002 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +2 Query: 8 ICSRYYRAPELIFGATDYTTKIDVWSAGCVVAEL 109 + SRY++ PEL+ +Y +D+WS GC++A + Sbjct: 22 VASRYFKGPELLVDHQEYDYSLDMWSFGCMLASM 55 >SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +2 Query: 2 SYICSRYYRAPELIFGATDYTTKIDVWSAGCV---VAELLLGQPIFPGDSGVDQLVEIIK 172 +Y+ SRYYRAPE+I G + ID+WS G V L +P+ P + V ++K Sbjct: 259 TYLQSRYYRAPEVILGLA-FCESIDMWSLGLCDTRVVSWLAFKPLAPPSLIRYEFVSLLK 317 Query: 173 VLGTPTREQ 199 + T +E+ Sbjct: 318 RMLTIDQEK 326 >SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) Length = 280 Score = 38.7 bits (86), Expect = 0.004 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 5 YICSRYYRAPELIFGATDYTTKIDVWSA 88 Y+ +R+YRAPE++ + Y+ ID+WSA Sbjct: 76 YVATRWYRAPEIMLNSKGYSKAIDIWSA 103 >SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1138 Score = 38.3 bits (85), Expect = 0.005 Identities = 35/123 (28%), Positives = 58/123 (47%) Frame = +2 Query: 14 SRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR 193 S YY APE++ G+ ++ + D+W+ GC++ EL G F ++ ++L E K+LG Sbjct: 180 SPYYMAPEVLMGSP-HSMQSDLWAFGCLLFELFTGDLPFVAET-FEELAE--KILG---- 231 Query: 194 EQIREMNPNYTEFKFPQIKSHPWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQACVHS 373 FP++K + A P+ +L+ LLE P R+S H Sbjct: 232 ------------HDFPEMKQSNETVLVGA--TPEFSNLIQGLLEKDPPKRISWGVVAKHP 277 Query: 374 FFD 382 F+D Sbjct: 278 FWD 280 >SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) Length = 888 Score = 38.3 bits (85), Expect = 0.005 Identities = 35/123 (28%), Positives = 58/123 (47%) Frame = +2 Query: 14 SRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR 193 S YY APE++ G+ ++ + D+W+ GC++ EL G F ++ ++L E K+LG Sbjct: 180 SPYYMAPEVLMGSP-HSMQSDLWAFGCLLFELFTGDLPFVAET-FEELAE--KILG---- 231 Query: 194 EQIREMNPNYTEFKFPQIKSHPWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQACVHS 373 FP++K + A P+ +L+ LLE P R+S H Sbjct: 232 ------------HDFPEMKQSNETVLVGA--TPEFSNLIQGLLEKDPPKRISWGVVAKHP 277 Query: 374 FFD 382 F+D Sbjct: 278 FWD 280 >SB_18360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +2 Query: 20 YYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQP 124 Y+ APE+I T + K D+WS GC V E+ GQP Sbjct: 6 YWMAPEVI-RETGHGRKSDIWSIGCTVFEMATGQP 39 >SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) Length = 501 Score = 37.9 bits (84), Expect = 0.007 Identities = 21/50 (42%), Positives = 30/50 (60%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIK 172 Y APE+I Y+ + DVWS G ++ L G+P F D+ ++L EIIK Sbjct: 152 YMAPEVI-DDLGYSQQCDVWSIGVIMYTLFTGRPPFMADT-EEKLYEIIK 199 >SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/52 (34%), Positives = 30/52 (57%) Frame = +2 Query: 20 YYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKV 175 YY +PE+ G +Y K D+W+ GC++ E+ Q F G + + +I+KV Sbjct: 190 YYISPEMCQGK-EYNHKSDIWALGCILYEMASRQKTFEGSNLPALVNKIMKV 240 >SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) Length = 967 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKV 175 + APE++ G + Y DVWS GCV+ E+ G+P + + L I K+ Sbjct: 786 FMAPEVLRGES-YGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKL 835 >SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDS 142 Y APE++ ++ ++DVWS GC++ LL+G+P F S Sbjct: 203 YIAPEVL-SKRGHSFEVDVWSVGCILYTLLVGKPPFETQS 241 >SB_26666| Best HMM Match : Pkinase (HMM E-Value=3.7e-38) Length = 1215 Score = 36.7 bits (81), Expect = 0.016 Identities = 27/89 (30%), Positives = 36/89 (40%), Gaps = 9/89 (10%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDS-------GVDQLVEIIKVLG 181 Y APEL G ++D+WS G V+ L+ G F G + +D I + Sbjct: 128 YAAPELFEGKEYLGPEVDIWSLGVVLYVLVCGALPFDGSTLQSLRSRVLDGRFRIPFFMS 187 Query: 182 TPTREQIREM--NPNYTEFKFPQIKSHPW 262 T IR M F PQI+ H W Sbjct: 188 TECEHLIRHMLVRDPVKRFTIPQIRQHKW 216 >SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 36.3 bits (80), Expect = 0.021 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAEL-LLGQPIFPGDSGVD 151 + A E + G +YTT DVWS G V+ E+ +G +PG +G D Sbjct: 605 WTAVEALIGGGEYTTLSDVWSFGVVLYEICTIGGEPYPGIAGKD 648 >SB_29639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 35.9 bits (79), Expect = 0.028 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = -2 Query: 174 TLIISTNWSTPESPGNIG*PNNSSATTHPALHTSIFVV 61 T ++ + ST SPGN G P SSA HP LH SI ++ Sbjct: 54 TSMMQASCSTSFSPGNSGYPVYSSARIHPKLHMSIAIL 91 >SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) Length = 187 Score = 35.1 bits (77), Expect = 0.049 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDS 142 Y APE+I Y +D WS G ++ E L+G P F GD+ Sbjct: 138 YLAPEVIL-RQGYGRAVDWWSMGIILYEFLMGVPPFYGDT 176 >SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 35.1 bits (77), Expect = 0.049 Identities = 27/108 (25%), Positives = 44/108 (40%), Gaps = 9/108 (8%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKV-------LG 181 Y APE++ G +DVWS G ++ L+ GQ F + + L +I+ + Sbjct: 81 YSAPEVLLGDAYEAPAVDVWSLGVILYMLVCGQAPFSEANDSETLTKIMDCRYDVPDHVS 140 Query: 182 TPTREQIREM--NPNYTEFKFPQIKSHPWAKVFRACTPPDAISLVSRL 319 + I M + +I SHPW + P + LV+ L Sbjct: 141 PLCKNLISRMLIREPHKRASLGEIMSHPWLQQGPTPLVPSDVPLVAEL 188 >SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 34.7 bits (76), Expect = 0.065 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGD 139 Y APE++ + YT +D+WS G + +L GQ F D Sbjct: 235 YMAPEVLL-SKPYTNSVDIWSIGVITFNVLSGQMPFADD 272 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 34.7 bits (76), Expect = 0.065 Identities = 23/67 (34%), Positives = 34/67 (50%) Frame = +2 Query: 8 ICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTP 187 I S Y +PEL G Y K DVWS GCV+ EL + F + +++I++ +P Sbjct: 164 IGSPCYISPELCEGKP-YNQKSDVWSLGCVLYELTTLKRAFEASNLPALVLKIMRGYFSP 222 Query: 188 TREQIRE 208 E+ E Sbjct: 223 IPERYSE 229 >SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 34.3 bits (75), Expect = 0.086 Identities = 21/53 (39%), Positives = 28/53 (52%) Frame = +2 Query: 14 SRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIK 172 SR+ APE++ D+WS G V LL GQ FPGD+ D + E +K Sbjct: 264 SRHGDAPEVL-SFEPVNMAADMWSVGIVTYALLSGQLPFPGDND-DAVEEAVK 314 >SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 34.3 bits (75), Expect = 0.086 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEII 169 Y APE++ Y D WS G ++ E+L+GQP F + + ++II Sbjct: 877 YIAPEVLL-RIGYRQSCDWWSVGVILYEMLVGQPPFLAPTPAETQLKII 924 >SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 854 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTP 187 Y PE++ + Y K DVW+AGC++ ++ QP F + + +I++ P Sbjct: 400 YSCPEVV-QSQPYGEKADVWAAGCILYQMATLQPPFYSSNMLALATKIVEASYAP 453 >SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) Length = 323 Score = 33.9 bits (74), Expect = 0.11 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 11 CSRY-YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVE 163 C Y Y APE++ G T DVWS G ++ +L G+ F DS + L++ Sbjct: 215 CGSYAYAAPEILKGIAYDATLADVWSMGVILYTMLCGRLPF-DDSNLRSLLQ 265 >SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 2 SYICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQP 124 +++ + ++ APE+I + Y +K D+WS G EL G+P Sbjct: 966 TFVGTPFWMAPEVIKQSA-YDSKADIWSLGITAIELAKGEP 1005 >SB_12642| Best HMM Match : Pkinase (HMM E-Value=5.3e-07) Length = 253 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 2 SYICSRYYRAPELIFGATDYTTKIDVWSAGCVVAELLLGQP 124 +++ + ++ APE+I + Y +K D+WS G EL G+P Sbjct: 32 TFVGTPFWMAPEVIKQSA-YDSKADIWSLGITAIELAKGEP 71 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 32.7 bits (71), Expect = 0.26 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIF 130 Y APE++ ++ ++D W+ GCV+ +L+G P F Sbjct: 597 YIAPEVL-SKEGHSYEVDTWALGCVMYTMLVGHPPF 631 >SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 32.7 bits (71), Expect = 0.26 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = +2 Query: 14 SRYYRAPELIFG----ATDYTTKIDVWSAGCVVAELLLGQPIFPGDSG 145 S Y APE++ A+ Y K D+WS G ++ +L G P F G G Sbjct: 264 SAEYMAPEVVDAFKTQASTYDKKCDLWSLGVILYIMLSGYPPFYGKCG 311 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 32.7 bits (71), Expect = 0.26 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 2/63 (3%) Frame = -2 Query: 444 KLKSGGSGRPLGRRAVGSRSSSKKLCTQACSGDRRAPGVYSSSRDTSEM--ASGGVHARN 271 K K G P G +GS + K L +A +G+ P + S + EM G RN Sbjct: 155 KFKRLGGKLPTGVLLIGSPGTGKTLLAKAVAGEAGVPFFFCSGSEFDEMFVGVGAARVRN 214 Query: 270 TFA 262 FA Sbjct: 215 LFA 217 >SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) Length = 239 Score = 32.3 bits (70), Expect = 0.35 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDS-GVDQLVEIIKVL 178 Y PE T Y + +VW+ GC + E+L G+ + G S +Q ++I K L Sbjct: 180 YCPPEYDSLRTYYRREANVWALGCTLYEMLTGRVAYKGPSQAANQPLQIPKFL 232 >SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) Length = 235 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIK 172 Y APE++ Y +D WS G + LL G P F DS + +I++ Sbjct: 177 YVAPEVL-KQQPYGKAVDCWSIGVITYILLCGYPPFYDDSDANLFAQIMR 225 >SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) Length = 1123 Score = 31.9 bits (69), Expect = 0.46 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +2 Query: 20 YYRAPELIFGATD--YTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEII 169 YY +PE+ Y K D+W+ GCV+ EL F D+ + +V+I+ Sbjct: 126 YYLSPEICQRQPYPCYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKIL 177 >SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) Length = 759 Score = 31.9 bits (69), Expect = 0.46 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPG-DSGVDQLVEIIK 172 Y APE++ Y K+D+W+AG + +L G P F + D+L ++I+ Sbjct: 610 YVAPEIL-EENGYGLKVDMWAAGVITYIMLCGFPPFRSPNRDQDELFDLIQ 659 >SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 668 Score = 31.5 bits (68), Expect = 0.61 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 9/79 (11%) Frame = +2 Query: 119 QPIFPGDSGVDQLVEIIKVLGTP-----TREQIREMNPNYTEFKFPQIKSHPWAKVFRAC 283 +P F G DQLV I KVLGT + E++P + + K W K + Sbjct: 505 EPFFHGHDNYDQLVRIAKVLGTEDLFDYIEKYHIELDPRFNDILGRHSKK-KWEKFVSSE 563 Query: 284 T----PPDAISLVSRLLEY 328 T P++I L+ LL Y Sbjct: 564 TSHLVSPESIDLLELLLRY 582 >SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 920 Score = 31.5 bits (68), Expect = 0.61 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 10/90 (11%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPG-------DSGVDQLVEIIKVLG 181 Y APE+ G ++D+WS G V+ L+ G F G D ++ I + Sbjct: 319 YAAPEVFEGKIYDGPQLDIWSLGVVLYVLVCGALPFDGSTLQALRDRVLEGKFRIPFFMS 378 Query: 182 TPTREQIREM---NPNYTEFKFPQIKSHPW 262 T IR M +PN + QI+ H W Sbjct: 379 TECEHLIRHMLVKDPN-QRYTIEQIQKHKW 407 >SB_50904| Best HMM Match : NACHT (HMM E-Value=2.3e-05) Length = 1122 Score = 31.5 bits (68), Expect = 0.61 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 188 TREQIREMNPNYTEFKFPQIKSHPWAKVFRACTPPDAISLVSRLLE 325 T+ ++ N + E +I S+P+AK FR C P D + V + +E Sbjct: 864 TKRHCKKNNEDDVEITQLKIASNPFAKGFRDCDPDDCVVEVMKQIE 909 >SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 31.5 bits (68), Expect = 0.61 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEII 169 Y APE++ Y +D W+ G ++ E++ GQP F ++ D I+ Sbjct: 484 YIAPEIL-QEQPYGFSVDWWALGVLMYEMMAGQPPFEAENEEDLFESIL 531 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 31.1 bits (67), Expect = 0.80 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = +2 Query: 23 YRAPELI--FGATDYTTKIDVWSAGCVVAEL 109 YRAPE++ + +TK D+W+ GC++ +L Sbjct: 1281 YRAPEMVDLYSGKIISTKSDIWALGCLLYKL 1311 >SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) Length = 286 Score = 31.1 bits (67), Expect = 0.80 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 8/68 (11%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIF--------PGDSGVDQLVEIIKVL 178 Y APE++ G DY +D W+ G ++ E+L G+ F P + D L + ++ L Sbjct: 190 YIAPEILRGE-DYGFSVDWWALGVLLYEMLAGRSPFDIVGSADNPDQNTEDYLFQELRAL 248 Query: 179 GTPTREQI 202 P + I Sbjct: 249 TAPLKNTI 256 >SB_1987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 31.1 bits (67), Expect = 0.80 Identities = 29/97 (29%), Positives = 40/97 (41%), Gaps = 17/97 (17%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDS----------GVDQLVEIIK 172 Y APE+I + D WS G ++ ELL G P F G+D +VE K Sbjct: 120 YVAPEIILNK-GHDLSSDYWSLGILIFELLTGSPPFSSSDPMKTYNIILRGLD-MVEFPK 177 Query: 173 VLGTPTREQIREM---NP----NYTEFKFPQIKSHPW 262 +G + I+ + NP Y + IK H W Sbjct: 178 RIGRNPQNLIKRLCKDNPVERLGYQKDGLSDIKKHKW 214 >SB_1344| Best HMM Match : HGTP_anticodon (HMM E-Value=4.4) Length = 168 Score = 31.1 bits (67), Expect = 0.80 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +2 Query: 59 YTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIK 172 Y K D+W+ GCV+ E+L + +F + + + +I+K Sbjct: 34 YNQKSDMWAVGCVLYEVLTLKRVFDASNPLRLVSDIVK 71 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 31.1 bits (67), Expect = 0.80 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDS 142 Y APEL G ++DVWS G ++ L+ G F G + Sbjct: 245 YAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQN 284 >SB_42409| Best HMM Match : Pkinase (HMM E-Value=6.7e-24) Length = 465 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIF 130 Y APE++ DY +D W G V+ E++ G P F Sbjct: 283 YLAPEVL-RKQDYDKSVDWWCLGAVLYEMMYGLPPF 317 >SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDS 142 Y APE+I + + +D W+ G ++ E+L+G P F D+ Sbjct: 202 YLAPEII-QSKGHNKAVDWWALGILIYEMLVGYPPFFDDN 240 >SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +2 Query: 2 SYICSRYYRAPELIFGAT----DYTTKIDVWSAGCVVAEL 109 ++I + Y+ APE++ T Y K D+WSAG + EL Sbjct: 388 TFIGTPYWMAPEVVVTETYKDDPYDYKADIWSAGITLIEL 427 >SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +2 Query: 59 YTTKIDVWSAGCVVAELL-LGQPIFPGDSGVDQLVEIIK 172 YTT+ DVW+ G ++ E+ LG +PG V++L E++K Sbjct: 928 YTTQSDVWTFGILLWEIFTLGGSPYPG-IPVEKLFELLK 965 >SB_23302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 653 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 65 TKIDVWSAGCVVAELLLGQPIF 130 T ++W+ GC+ AELL +PIF Sbjct: 196 TTPNIWAIGCIFAELLTCEPIF 217 >SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 786 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 74 DVWSAGCVVAELLLGQPIF 130 DVWS GC++ LL+G+P F Sbjct: 93 DVWSIGCMLFTLLVGKPPF 111 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 246 SRVTLGRRCSARARPRTPSRWCRG 317 +R T GR C ARP T RWC G Sbjct: 108 TRETHGRECKICARPFTIFRWCPG 131 >SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) Length = 348 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQ 121 + APE++ T YT +D W G ++ E+L+G+ Sbjct: 317 FLAPEVLT-ETSYTRAVDWWGLGVLIFEMLVGE 348 >SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 29.5 bits (63), Expect = 2.4 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQI 202 YRAPEL+ G T +TK D++S G + ++L + + + +Q V I V+ R +I Sbjct: 205 YRAPELLRGETP-STKADIYSYGICLWQMLTRERPYGNE---NQHVVIFGVVAYQLRPRI 260 Query: 203 -REMN 214 R+M+ Sbjct: 261 ARDMS 265 >SB_29500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQ 121 Y APE++ G YT D WS G V+ LL G+ Sbjct: 122 YMAPEVLKGEC-YTAACDWWSLGIVMFTLLAGK 153 >SB_22883| Best HMM Match : Pkinase (HMM E-Value=6.4e-12) Length = 326 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/41 (29%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 23 YRAPELIFGATDYTT-KIDVWSAGCVVAELLLGQPIFPGDS 142 ++ PE+ G ++ K+D+W+AG + + G+ F GD+ Sbjct: 161 FQPPEIANGLETFSGFKVDIWAAGVTLYNITTGKYPFEGDN 201 >SB_10993| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-38) Length = 344 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 59 YTTKIDVWSAGCVVAELLLGQPI-FPGDSGVDQL 157 YTTK DVWS G ++ E+ G + + G SGV+ L Sbjct: 222 YTTKSDVWSYGVLLWEMESGALMPYAGMSGVEIL 255 >SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) Length = 632 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIF 130 Y APE++ YT D W GC++ E++ G+ F Sbjct: 250 YMAPEVVKNER-YTFSPDWWGLGCLIYEMIQGKSPF 284 >SB_23137| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1022 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 59 YTTKIDVWSAGCVVAELLLGQPI-FPGDSGVDQL 157 YTTK DVWS G ++ E+ G + + G SGV+ L Sbjct: 900 YTTKSDVWSYGVLLWEMESGALMPYAGMSGVEIL 933 >SB_55159| Best HMM Match : Ribosomal_S17e (HMM E-Value=2.8) Length = 250 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 32 PELIFGATDYTTKIDVWSAGCVVAELLLGQ-PIFPGD 139 PE + G YT + D+WS G + E+ +G+ PI P D Sbjct: 162 PERLQG-NQYTIQSDIWSFGLSLVEMAIGRYPIPPPD 197 >SB_20165| Best HMM Match : Pkinase (HMM E-Value=0.00013) Length = 150 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLG 118 YRAPE+ G Y + D++S G + EL+ G Sbjct: 61 YRAPEVARGDVAYNKEADMYSFGMFLYELVTG 92 >SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) Length = 284 Score = 29.1 bits (62), Expect = 3.2 Identities = 31/104 (29%), Positives = 48/104 (46%) Frame = +2 Query: 74 DVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKS 253 D+WS G V+ +L G P P S V + K L R +I E+ FP+ Sbjct: 92 DMWSLGVVIYIMLCGYP--PFYSEVPR-----KQLSQGMRRRIMA-----GEYSFPE--- 136 Query: 254 HPWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQACVHSFFDE 385 W+K+ +A ++S+LL PG RLS + HS+ ++ Sbjct: 137 QEWSKI-----SLEAKDVISKLLCVEPGQRLSINELLEHSWLNQ 175 >SB_40177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 163 NYQGFRDTDKRTNPRDESKLYRI*VSANQESPLGEGVPRVH 285 N+Q ++D R N R ++ I +++N + L G+ R H Sbjct: 25 NFQSYKDYPNRRNSRSSTRKATILMNSNGGAVLSSGIHRFH 65 >SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 893 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQ 121 + APE+I T ++ DVWS G V+ ELL GQ Sbjct: 254 WMAPEVIRTNT-FSFASDVWSYGVVLWELLTGQ 285 >SB_19325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 23 YRAPELIFGATDYTTK-IDVWSAGCVVAELLLG 118 Y APE++ G DY + D+WS G V+ +L G Sbjct: 135 YVAPEVL-GKMDYRAQPADIWSCGIVLVAMLAG 166 >SB_14578| Best HMM Match : Gal_Lectin (HMM E-Value=0.72) Length = 502 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -2 Query: 417 PLGRRAVGSRSSSKKLCTQACSGDRRAPGVYSSSRDTSEMASGGVH 280 PL R VGS+++ K + ++A GDR+ D E G V+ Sbjct: 291 PLLREVVGSQNTKKSIVSRASEGDRKEREGVRPGSDFLEERRGDVY 336 >SB_56450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 163 NYQGFRDTDKRTNPRDESKLYRI*VSANQESPLGEGVPRVH 285 N+Q ++D R N R ++ I +++N + L G+ R H Sbjct: 25 NFQSYKDYPNRRNSRSSTRKATILMNSNGGAVLSSGIHRFH 65 >SB_7684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 59 YTTKIDVWSAGCVVAELLLGQPIF 130 Y K D+WS GC++ EL P F Sbjct: 8 YNEKSDIWSLGCLMYELCALSPPF 31 >SB_56801| Best HMM Match : T-box (HMM E-Value=0) Length = 287 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 242 QIKSHPWAKVFRACTPPDAISLVSRLLE 325 +I S+P+AK FR C P D + V + +E Sbjct: 209 KIASNPFAKGFRDCDPDDCVVEVMKQIE 236 >SB_42678| Best HMM Match : Helicase_C (HMM E-Value=1.4e-24) Length = 1058 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -2 Query: 447 VKLKSGGSGRPLG--RRAVGSRSSSKKLCTQACSGDRRAPGVYSSSRDTSE 301 +KL G G+P G ++G +S KKLC Q ++ + RDT++ Sbjct: 318 IKLAEGSKGKPGGVSTSSLGFITSLKKLCNQNSKRQKQIDVLKMLRRDTTD 368 >SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) Length = 436 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 62 TTKIDVWSAGCVVAELLLGQPIFPGDSGVDQLVE 163 ++K+DVWS G + ++L G+ F D ++E Sbjct: 340 SSKVDVWSVGVIFYQMLYGRKPFGHDQTQASILE 373 >SB_3529| Best HMM Match : T-box (HMM E-Value=0) Length = 512 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 242 QIKSHPWAKVFRACTPPDAISLVSRLLE 325 +I S+P+AK FR C P D + V + L+ Sbjct: 336 KIASNPFAKGFRECDPDDCVIEVMKQLD 363 >SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 71 IDVWSAGCVVAELLLGQPIFPGDSGVDQLVEIIK 172 +D+W+ G + LL+G P F +S L+ I++ Sbjct: 211 VDIWACGVIFYLLLVGYPPFWSNSDEQLLLSILR 244 >SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2468 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +2 Query: 257 PWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQACVHSFFDELREPTARL 409 PW + F+A DAI ++ + Y P QA V ++ LR+P L Sbjct: 324 PWKRAFKAMLS-DAIVSPTQEINYLRKFTSGPPQALVDNYRKRLRDPATLL 373 >SB_7401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 403 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +3 Query: 231 LSFRKSR--VTLGRRCSARARPRTPSRWCRG 317 L F+KSR V L ++C +P TP+ W G Sbjct: 43 LYFKKSRLNVLLVKKCQTLTKPFTPTFWASG 73 >SB_4916| Best HMM Match : PspA_IM30 (HMM E-Value=3.7) Length = 331 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +2 Query: 257 PWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQACVHSFFDELREPTARL 409 PW + F+A DAI ++ + Y P QA V ++ LR+P L Sbjct: 91 PWRRAFKAMLS-DAIVSPTQEINYLRKFTSGPPQALVDNYRKRLRDPATLL 140 >SB_55996| Best HMM Match : DUF1694 (HMM E-Value=6.9) Length = 167 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 57 TTPRKLTCGARDALSLSCCWVNRYSQEIPGLTNWLKL 167 T R C ARD SL ++ + +E+ G+ N +KL Sbjct: 85 TISRHNDCNARDISSLLKFYLRKKKEEVVGIINGIKL 121 >SB_51460| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-33) Length = 1584 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +2 Query: 257 PWAKVFRACTPPDAISLVSRLLEYTPGARLSPLQACVHSFFDELREPTARL 409 PW + F+A DAI ++ + Y P QA V ++ LR+P L Sbjct: 210 PWKRAFKAMLS-DAIVSPTQEINYLRKFTSGPPQALVDNYRKRLRDPATLL 259 >SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +2 Query: 23 YRAPE-LIFGATD---YTTKIDVWSAGCVVAELLLGQ 121 Y APE +F AT+ Y +ID++S G + E +LG+ Sbjct: 180 YMAPETFVFAATNSAIYGPEIDIFSFGMTMLETILGR 216 >SB_36284| Best HMM Match : Pkinase (HMM E-Value=0.41) Length = 176 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +2 Query: 11 CSRYYR--APELIFGATDYTTKIDVWSAGCVVAELLLGQ 121 C + R APE++ G YT D WS G V+ LL G+ Sbjct: 12 CDEFGRREAPEVLKGEC-YTAACDWWSLGIVMFTLLAGK 49 >SB_36067| Best HMM Match : Pkinase (HMM E-Value=0.073) Length = 102 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLG 118 Y APE++ Y + D +S GC++ +LL+G Sbjct: 71 YMAPEVLKKGEAYDSCADWFSLGCMLFKLLVG 102 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 23 YRAPELIFGATDYTTKIDVWSAGCVVAELLLGQPIF 130 Y +PE++ Y +D+W+ G ++ LL+G P F Sbjct: 183 YLSPEVL-KKDPYGKPVDLWACGVILYILLVGYPPF 217 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,057,217 Number of Sequences: 59808 Number of extensions: 306360 Number of successful extensions: 1092 Number of sequences better than 10.0: 94 Number of HSP's better than 10.0 without gapping: 989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1082 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -