BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0271 (477 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75548-4|CAA99912.1| 117|Caenorhabditis elegans Hypothetical pr... 29 1.7 AF040642-3|AAN73872.2| 502|Caenorhabditis elegans Hypothetical ... 27 7.0 Z34802-4|CAA84335.4| 365|Caenorhabditis elegans Hypothetical pr... 27 9.2 AF047657-2|AAK18950.2| 358|Caenorhabditis elegans Serpentine re... 27 9.2 >Z75548-4|CAA99912.1| 117|Caenorhabditis elegans Hypothetical protein R90.4 protein. Length = 117 Score = 29.1 bits (62), Expect = 1.7 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 172 CSRKFLARYKIPGAHSKRGSYAERNFDFRAL 264 CS+KF KIP + RGS AER +D L Sbjct: 74 CSKKFTI--KIPKDYINRGSQAERTYDIGTL 102 >AF040642-3|AAN73872.2| 502|Caenorhabditis elegans Hypothetical protein C50D2.7 protein. Length = 502 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 187 KTFSSTVFSFKHLLIYLHTPFF 122 +TF ++FS+KH L++L FF Sbjct: 4 ETFVPSIFSYKHRLLHLSVLFF 25 >Z34802-4|CAA84335.4| 365|Caenorhabditis elegans Hypothetical protein M88.4 protein. Length = 365 Score = 26.6 bits (56), Expect = 9.2 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -2 Query: 296 SPRHLALSGCTSARKSKFLSA*LPRLLCAPGILYRAKNFLEH 171 SP H+ C SA ++ + A L LL P + R+ N LEH Sbjct: 117 SPMHVHCYRCDSAETAQIMLANLQLLLSRPDV-QRSINDLEH 157 >AF047657-2|AAK18950.2| 358|Caenorhabditis elegans Serpentine receptor, class h protein270 protein. Length = 358 Score = 26.6 bits (56), Expect = 9.2 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -3 Query: 217 YALLVSYTALKTFSSTVFSFKHLLIYLHTPFF*VYSH*IHLTITIIFNSFY 65 Y +L+SY+AL + T+F ++ L++ + Y H L I I +S Y Sbjct: 101 YLILISYSALGSSILTLFENRYFLMFAKHSSWRNYRH-PFLIINYIISSVY 150 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,507,841 Number of Sequences: 27780 Number of extensions: 96274 Number of successful extensions: 211 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 211 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 871571276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -