BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0268 (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 24 1.1 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 24 1.1 DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 22 3.5 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 6.1 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 6.1 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 23.8 bits (49), Expect = 1.1 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 77 HYCVSVKLQCVFW 115 HYC+ V C FW Sbjct: 114 HYCLFVASNCFFW 126 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 23.8 bits (49), Expect = 1.1 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 77 HYCVSVKLQCVFW 115 HYC+ V C FW Sbjct: 114 HYCLFVASNCFFW 126 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 22.2 bits (45), Expect = 3.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 143 KMSWGVELWDQYDNLAAHTHKGIEFLDKYG 232 K SW EL ++YD + + FL++ G Sbjct: 93 KPSWWQELQEKYDPKGEYKSRYNHFLEEEG 122 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 422 QSNVVRELHLLAKELREERKQHLNEGA 502 + V++ LH + + ERK+H + + Sbjct: 234 EQKVLKSLHSFSNNVIAERKKHFSSSS 260 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 422 QSNVVRELHLLAKELREERKQHLNEGA 502 + V++ LH + + ERK+H + + Sbjct: 234 EQKVLKSLHSFSNNVIAERKKHFSSSS 260 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,188 Number of Sequences: 336 Number of extensions: 2988 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -