BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0268 (605 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 5.8 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.7 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.4 bits (48), Expect = 5.8 Identities = 17/64 (26%), Positives = 32/64 (50%) Frame = +2 Query: 305 QPKRKEEDEYQYTACKAFKQLLQELGDFAGQREVVAENLQSNVVRELHLLAKELREERKQ 484 QP+++++ +Y + +QL Q+ QR VVA + Q ++ H ++ R+ K Sbjct: 328 QPQQQQQQTGRYQPPQMRQQLQQQQQQRQPQRYVVAGSSQQQ--QQQHQQQQQKRKRPKP 385 Query: 485 HLNE 496 L E Sbjct: 386 ELIE 389 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 549 PGERTNVRRGSRKEH 593 PG N+RRGSR H Sbjct: 554 PGSPFNLRRGSRGSH 568 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,350 Number of Sequences: 2352 Number of extensions: 12970 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -