BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0267 (707 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 2.3 Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein ... 23 7.1 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 9.4 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 23 9.4 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.0 bits (52), Expect = 2.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 Query: 412 SCRRGAGILFPTTACHGPHSLRGRDSWTPEGSH 314 SC R AG F T+ S R S + GSH Sbjct: 1330 SCERIAGETFECTSTSSKFSTSSRGSGSDSGSH 1362 >Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein protein. Length = 134 Score = 23.4 bits (48), Expect = 7.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 343 RDSWTPEGSHHTQTT 299 ++ W PE +HH Q T Sbjct: 37 KEKWVPEITHHCQKT 51 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 446 ETTSVPASIGFMGFTMSAKGGITLNYGKTFTDCFN 550 ++T P SI + G T + + + F DCF+ Sbjct: 479 KSTHTPKSITYKGATSANTNEMCNLFADRFADCFS 513 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 299 GCLSMVASLRSPTISSSE 352 GCLS + S RS T+S E Sbjct: 156 GCLSFIPSKRSITVSWDE 173 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 783,976 Number of Sequences: 2352 Number of extensions: 17002 Number of successful extensions: 40 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -