BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0256 (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 27 0.11 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 7.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.1 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 27.1 bits (57), Expect = 0.11 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 216 DEMRRRRNEVT-VELRKNKREETLQKRRNVPISYSTDEEEIDK 341 ++ ++ RNE ++LR +EE LQ RR + E+E +K Sbjct: 13 EKFKQLRNEDNKIDLRSRTKEERLQYRREAWLVQQEREQEYEK 55 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.0 bits (42), Expect = 7.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 174 KNRMHVFKNAGKDVDEMRRRRNEVTVELRKNKRE 275 K + + + GKD M R ++ E RKNK + Sbjct: 440 KKMLKIKRLFGKDRKIMDMVREKIIEEKRKNKNK 473 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 7.1 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 Query: 220 SSTSLPAFLNTCMRFFA*SVAILSVLAVSTQYVVITQ 110 SSTSLPA + T + A + A +T +I Q Sbjct: 99 SSTSLPATITTTTTTTTTTTATAAATATTTATGLIKQ 135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,845 Number of Sequences: 438 Number of extensions: 2606 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -