Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Nnor0254
         (364 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g54550.1 68414.m06221 F-box family protein contains Pfam:PF00...    27   2.8  

>At1g54550.1 68414.m06221 F-box family protein contains Pfam:PF00646
           F-box domain; contains TIGRFAM TIGR01640 : F-box protein
           interaction domain
          Length = 362

 Score = 27.5 bits (58), Expect = 2.8
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%)
 Frame = -1

Query: 352 HDNFLNNYVAISG*-YFLSRLFGRCPSLMKPP 260
           H+ F +N V++ G  YF  R   R P L KPP
Sbjct: 189 HELFSHNSVSLKGNTYFFGRKGPRLPMLFKPP 220


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,800,777
Number of Sequences: 28952
Number of extensions: 31420
Number of successful extensions: 54
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 54
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54
length of database: 12,070,560
effective HSP length: 73
effective length of database: 9,957,064
effective search space used: 467982008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)