BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0253 (305 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 2.0 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 2.6 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 22 6.0 AY330173-1|AAQ16279.1| 202|Anopheles gambiae odorant-binding pr... 21 7.9 AJ618917-1|CAF01996.1| 199|Anopheles gambiae putative odorant-b... 21 7.9 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 134 RRSKGHC*QKDRCVACCTCAAR 199 RRS HC Q+ R +C AA+ Sbjct: 38 RRSSAHCTQQTRQASCSDNAAQ 59 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 121 KIAGASIEGTLLTEGSVRCVLYVRGARLSIVC 216 K+A G + E + RC+ VRGA+ + C Sbjct: 451 KMADMYSVGLVFWEMARRCITTVRGAKNTTTC 482 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 231 HSSRGTDDRQPRAAHVQHATHRS 163 H SR + R+ R A H+ HRS Sbjct: 512 HESRANNFRRKRFAGGGHSHHRS 534 >AY330173-1|AAQ16279.1| 202|Anopheles gambiae odorant-binding protein AgamOBP46 protein. Length = 202 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 222 RGTDDRQPRAAHVQHATHRSFCQQCPFDRRSS 127 +GT P A+ + H + CP + RS+ Sbjct: 150 KGTQVCNPEASFLVDCIHTTVFSDCPTNLRST 181 >AJ618917-1|CAF01996.1| 199|Anopheles gambiae putative odorant-binding protein OBPjj1 protein. Length = 199 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 222 RGTDDRQPRAAHVQHATHRSFCQQCPFDRRSS 127 +GT P A+ + H + CP + RS+ Sbjct: 147 KGTQVCNPEASFLVDCIHTTVFSDCPTNLRST 178 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 329,325 Number of Sequences: 2352 Number of extensions: 6904 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19992474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -