BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0253 (305 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X04526-2|CAA28207.1| 340|Homo sapiens protein ( Human liver mRN... 31 0.66 CR456784-1|CAG33065.1| 340|Homo sapiens GNB1 protein. 31 0.66 BT007305-1|AAP35969.1| 340|Homo sapiens guanine nucleotide bind... 31 0.66 BC114618-1|AAI14619.1| 332|Homo sapiens GNB1 protein protein. 31 0.66 BC008991-1|AAH08991.1| 340|Homo sapiens guanine nucleotide bind... 31 0.66 BC005888-1|AAH05888.1| 340|Homo sapiens guanine nucleotide bind... 31 0.66 BC004186-1|AAH04186.1| 340|Homo sapiens guanine nucleotide bind... 31 0.66 AL109917-5|CAI95654.1| 340|Homo sapiens guanine nucleotide bind... 31 0.66 AL109917-4|CAI95653.1| 147|Homo sapiens guanine nucleotide bind... 31 0.66 AL109917-3|CAI95651.1| 108|Homo sapiens guanine nucleotide bind... 31 0.66 AL109917-2|CAI95652.1| 134|Homo sapiens guanine nucleotide bind... 31 0.66 AL031282-2|CAI20029.1| 340|Homo sapiens guanine nucleotide bind... 31 0.66 AF501882-1|AAM15918.1| 340|Homo sapiens guanine nucleotide bind... 31 0.66 M36429-1|AAA63264.1| 340|Homo sapiens protein ( Human transduci... 28 4.6 M16538-1|AAA35922.1| 340|Homo sapiens protein ( Human signal-tr... 28 4.6 M16514-1|AAA03179.1| 340|Homo sapiens GNB2 protein. 28 4.6 CR541729-1|CAG46530.1| 340|Homo sapiens GNB2 protein. 28 4.6 BC068003-1|AAH68003.1| 340|Homo sapiens guanine nucleotide bind... 28 4.6 BC012348-1|AAH12348.1| 340|Homo sapiens guanine nucleotide bind... 28 4.6 BC010073-1|AAH10073.1| 340|Homo sapiens guanine nucleotide bind... 28 4.6 BC000873-1|AAH00873.1| 340|Homo sapiens guanine nucleotide bind... 28 4.6 AF501883-1|AAM15919.1| 340|Homo sapiens guanine nucleotide bind... 28 4.6 AF300648-1|AAG18442.1| 340|Homo sapiens guanine nucleotide bind... 28 4.6 AF053356-4|AAC78794.1| 340|Homo sapiens GNB2 protein. 28 4.6 U78313-1|AAB39748.1| 246|Homo sapiens myogenic repressor I-mf p... 27 8.1 BC106907-1|AAI06908.1| 345|Homo sapiens amyotrophic lateral scl... 27 8.1 BC106906-1|AAI06907.1| 345|Homo sapiens amyotrophic lateral scl... 27 8.1 BC065010-1|AAH65010.1| 394|Homo sapiens ALS2CR13 protein protein. 27 8.1 BC007836-1|AAH07836.1| 246|Homo sapiens MyoD family inhibitor p... 27 8.1 AL035588-17|CAI22456.1| 231|Homo sapiens MyoD family inhibitor ... 27 8.1 AL035588-16|CAD92607.1| 185|Homo sapiens MyoD family inhibitor ... 27 8.1 AL035588-15|CAB54148.1| 246|Homo sapiens MyoD family inhibitor ... 27 8.1 AL035588-14|CAO72132.1| 213|Homo sapiens MyoD family inhibitor ... 27 8.1 AK096090-1|BAC04700.1| 345|Homo sapiens protein ( Homo sapiens ... 27 8.1 AC098831-1|AAY24090.1| 269|Homo sapiens unknown protein. 27 8.1 >X04526-2|CAA28207.1| 340|Homo sapiens protein ( Human liver mRNA for beta-subunit signal transducing proteins Gs/Gi (beta-G). ). Length = 340 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >CR456784-1|CAG33065.1| 340|Homo sapiens GNB1 protein. Length = 340 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >BT007305-1|AAP35969.1| 340|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 protein. Length = 340 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >BC114618-1|AAI14619.1| 332|Homo sapiens GNB1 protein protein. Length = 332 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >BC008991-1|AAH08991.1| 340|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 protein. Length = 340 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >BC005888-1|AAH05888.1| 340|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 protein. Length = 340 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >BC004186-1|AAH04186.1| 340|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 protein. Length = 340 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >AL109917-5|CAI95654.1| 340|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 protein. Length = 340 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >AL109917-4|CAI95653.1| 147|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 protein. Length = 147 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >AL109917-3|CAI95651.1| 108|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 protein. Length = 108 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >AL109917-2|CAI95652.1| 134|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 protein. Length = 134 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >AL031282-2|CAI20029.1| 340|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 1 protein. Length = 340 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >AF501882-1|AAM15918.1| 340|Homo sapiens guanine nucleotide binding protein beta 1 protein. Length = 340 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+ELD+LRQEAE LKN I Sbjct: 1 MSELDQLRQEAEQLKNQI 18 >M36429-1|AAA63264.1| 340|Homo sapiens protein ( Human transducin beta-2 subunit mRNA, complete cds. ). Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >M16538-1|AAA35922.1| 340|Homo sapiens protein ( Human signal-transducing guanine nucleotide-binding regulatory (G) protein beta subunit mRNA, complete cds. ). Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >M16514-1|AAA03179.1| 340|Homo sapiens GNB2 protein. Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >CR541729-1|CAG46530.1| 340|Homo sapiens GNB2 protein. Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >BC068003-1|AAH68003.1| 340|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 2 protein. Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >BC012348-1|AAH12348.1| 340|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 2 protein. Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >BC010073-1|AAH10073.1| 340|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 2 protein. Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >BC000873-1|AAH00873.1| 340|Homo sapiens guanine nucleotide binding protein (G protein), beta polypeptide 4 protein. Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >AF501883-1|AAM15919.1| 340|Homo sapiens guanine nucleotide binding protein beta 2 protein. Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >AF300648-1|AAG18442.1| 340|Homo sapiens guanine nucleotide binding protein beta subunit 4 protein. Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >AF053356-4|AAC78794.1| 340|Homo sapiens GNB2 protein. Length = 340 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +2 Query: 251 MNELDRLRQEAETLKNAI 304 M+EL++LRQEAE L+N I Sbjct: 1 MSELEQLRQEAEQLRNQI 18 >U78313-1|AAB39748.1| 246|Homo sapiens myogenic repressor I-mf protein. Length = 246 Score = 27.5 bits (58), Expect = 8.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 146 GHC*QKDRCVACCTCAARGC 205 G C +D C+ CC C + C Sbjct: 190 GSCSSEDSCLCCCCCGSGEC 209 >BC106907-1|AAI06908.1| 345|Homo sapiens amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 13 protein. Length = 345 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 3 DCSVIKTCEISLF*CGDIEKIQNVPKSGYPILMV 104 +CS + EI F C D K+ +PKSG +V Sbjct: 238 ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLV 271 >BC106906-1|AAI06907.1| 345|Homo sapiens amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 13 protein. Length = 345 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 3 DCSVIKTCEISLF*CGDIEKIQNVPKSGYPILMV 104 +CS + EI F C D K+ +PKSG +V Sbjct: 238 ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLV 271 >BC065010-1|AAH65010.1| 394|Homo sapiens ALS2CR13 protein protein. Length = 394 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 3 DCSVIKTCEISLF*CGDIEKIQNVPKSGYPILMV 104 +CS + EI F C D K+ +PKSG +V Sbjct: 287 ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLV 320 >BC007836-1|AAH07836.1| 246|Homo sapiens MyoD family inhibitor protein. Length = 246 Score = 27.5 bits (58), Expect = 8.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 146 GHC*QKDRCVACCTCAARGC 205 G C +D C+ CC C + C Sbjct: 190 GSCSSEDSCLCCCCCGSGEC 209 >AL035588-17|CAI22456.1| 231|Homo sapiens MyoD family inhibitor protein. Length = 231 Score = 27.5 bits (58), Expect = 8.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 146 GHC*QKDRCVACCTCAARGC 205 G C +D C+ CC C + C Sbjct: 190 GSCSSEDSCLCCCCCGSGEC 209 >AL035588-16|CAD92607.1| 185|Homo sapiens MyoD family inhibitor protein. Length = 185 Score = 27.5 bits (58), Expect = 8.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 146 GHC*QKDRCVACCTCAARGC 205 G C +D C+ CC C + C Sbjct: 129 GSCSSEDSCLCCCCCGSGEC 148 >AL035588-15|CAB54148.1| 246|Homo sapiens MyoD family inhibitor protein. Length = 246 Score = 27.5 bits (58), Expect = 8.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 146 GHC*QKDRCVACCTCAARGC 205 G C +D C+ CC C + C Sbjct: 190 GSCSSEDSCLCCCCCGSGEC 209 >AL035588-14|CAO72132.1| 213|Homo sapiens MyoD family inhibitor protein. Length = 213 Score = 27.5 bits (58), Expect = 8.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 146 GHC*QKDRCVACCTCAARGC 205 G C +D C+ CC C + C Sbjct: 190 GSCSSEDSCLCCCCCGSGEC 209 >AK096090-1|BAC04700.1| 345|Homo sapiens protein ( Homo sapiens cDNA FLJ38771 fis, clone KIDNE2016388. ). Length = 345 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 3 DCSVIKTCEISLF*CGDIEKIQNVPKSGYPILMV 104 +CS + EI F C D K+ +PKSG +V Sbjct: 238 ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLV 271 >AC098831-1|AAY24090.1| 269|Homo sapiens unknown protein. Length = 269 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 3 DCSVIKTCEISLF*CGDIEKIQNVPKSGYPILMV 104 +CS + EI F C D K+ +PKSG +V Sbjct: 162 ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLV 195 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,060,011 Number of Sequences: 237096 Number of extensions: 866421 Number of successful extensions: 5887 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 5820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5887 length of database: 76,859,062 effective HSP length: 78 effective length of database: 58,365,574 effective search space used: 1342408202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -