BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0251 (575 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0714 - 6312718-6313095 31 0.87 03_05_0435 - 24259864-24260206,24260302-24260467,24261175-242612... 28 4.6 11_01_0530 - 4164590-4165264,4165378-4165467,4167482-4168011,416... 28 6.1 04_03_0801 - 19828175-19828770,19828913-19828994 27 8.1 >08_01_0714 - 6312718-6313095 Length = 125 Score = 30.7 bits (66), Expect = 0.87 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 453 PESARWRGDKVAYMPVALGSLGGEGEYR 536 P + R+ GD+V P ALGS G G+ R Sbjct: 44 PTAGRYVGDRVGLQPAALGSSGSNGKGR 71 >03_05_0435 - 24259864-24260206,24260302-24260467,24261175-24261241, 24261553-24261648,24261718-24261898,24262252-24262323, 24262393-24262505,24262596-24262817,24263262-24263910, 24264118-24264206,24265932-24266015,24266219-24266358, 24266522-24266573 Length = 757 Score = 28.3 bits (60), Expect = 4.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 81 RSYCASELCECAWRGIVCAV 140 RSYC + CEC G+ C++ Sbjct: 554 RSYCVKKYCECFQSGVGCSM 573 >11_01_0530 - 4164590-4165264,4165378-4165467,4167482-4168011, 4168094-4168603,4172207-4172432 Length = 676 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 Query: 205 ISRLARGAPPSAVSLSQADTLITAQTMPRHAHSH 104 +S + R APPS L +D L R H H Sbjct: 282 VSAIVRAAPPSTAFLKDSDGLSAIHVAARMGHHH 315 >04_03_0801 - 19828175-19828770,19828913-19828994 Length = 225 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 84 SYCASELCECAWRGIVCAVI 143 S+CA EL C WR C +I Sbjct: 47 SFCAEELRTCIWRKAGCKII 66 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,296,295 Number of Sequences: 37544 Number of extensions: 208922 Number of successful extensions: 630 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1340735508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -