BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0240 (492 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 26 0.19 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 1.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.4 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 5.4 EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 21 7.1 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 7.1 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 7.1 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 7.1 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 7.1 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 7.1 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 26.2 bits (55), Expect = 0.19 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +2 Query: 113 FSLFDKDGDGTITTKELGTVMRS--LGQNPTEAELQDMINEVDADGNGTIDFPEF 271 FS +D++ +G + +EL + L + L MI+ D DG+G ++ EF Sbjct: 242 FSHYDRNNNGNLEREELEQFAENEDLEELCRGCNLGHMISYDDTDGDGKLNVNEF 296 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.4 bits (48), Expect = 1.3 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -3 Query: 430 DLLVSEFLS--EVGHDVAQLGRGDEAVAVLVE 341 DL S+ L E+ HDVA G+G E V++ V+ Sbjct: 163 DLNTSQLLKQVEIPHDVATTGKG-ELVSLTVQ 193 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 320 FLPRYPCPSSCAP 282 F P Y P++CAP Sbjct: 1803 FSPEYDDPANCAP 1815 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 5.4 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 314 PRYPCPSSCAPSLSRTRESLSCRFRP 237 P P P P++ R R L+ RF P Sbjct: 372 PPTPFPRFIPPNVYRFRPPLNPRFEP 397 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 21.0 bits (42), Expect = 7.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 120 CSTKTAMAPSRPKSWA 167 C+T T AP RP A Sbjct: 8 CTTATLAAPQRPSGGA 23 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 314 PRYPCPSSCAPSLSRTRESLSCRFRP 237 P P P P+ R R L+ RF P Sbjct: 149 PSTPFPRFIPPNAYRFRPPLNPRFEP 174 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 314 PRYPCPSSCAPSLSRTRESLSCRFRP 237 P P P P+ R R L+ RF P Sbjct: 152 PSTPFPRFIPPNAYRFRPPLNPRFEP 177 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 314 PRYPCPSSCAPSLSRTRESLSCRFRP 237 P P P P+ R R L+ RF P Sbjct: 152 PSTPFPRFIPPNAYRFRPPLNPRFEP 177 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 314 PRYPCPSSCAPSLSRTRESLSCRFRP 237 P P P P+ R R L+ RF P Sbjct: 152 PSTPFPRFIPPNAYRFRPPLNPRFEP 177 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 314 PRYPCPSSCAPSLSRTRESLSCRFRP 237 P P P P+ R R L+ RF P Sbjct: 152 PSTPFPRFIPPNAYRFRPPLNPRFEP 177 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,692 Number of Sequences: 438 Number of extensions: 1718 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -