BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0234 (683 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 27 0.73 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 26 0.96 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 26 1.3 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 25 1.7 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 25 1.7 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 25 1.7 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 3.9 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 6.8 AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 23 9.0 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 9.0 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 26.6 bits (56), Expect = 0.73 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +1 Query: 253 GEGGASVVGALDTDGAVAVDLNAVAEATLNHEGQIILTADDGHGYPVSVSGVI--TVPVS 426 G GG+S G L TDG+ + A+ ++ ++ Q G G P S+SG + T PVS Sbjct: 322 GSGGSSGGGLLGTDGSQY--YTSAADPSMGNDPQ------TGMGGPASMSGSLSATSPVS 373 Query: 427 ASVYQS 444 + Q+ Sbjct: 374 PHLQQN 379 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 26.2 bits (55), Expect = 0.96 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 224 SGSVMMGLLGSTWMRETLPSGLVMVCSTAGAY-CD 123 SG M+ L TW+ E++PS +V+ + Y CD Sbjct: 31 SGFEMLALT-ETWLNESIPSNMVLDSDSYNIYRCD 64 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.8 bits (54), Expect = 1.3 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 94 DEKGPPTQPMSQYAPAVLQTITNPDGSVSLIQVDPNNP 207 DE+G + + + AP + T+T PDG ++I+ NNP Sbjct: 896 DEEGRLPRRLKR-AP-IKDTVTIPDGGYTIIRFIANNP 931 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 125 VVIGTYKIHRREDLYP 140 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 125 VVIGTYKIHRREDLYP 140 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 125 VVIGTYKIHRREDLYP 140 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 125 VVIGTYKIHRREDLYP 140 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 128 VVIGTYKIHRREDLYP 143 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 128 VVIGTYKIHRREDLYP 143 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 137 VVIGTYKIHRREDLYP 152 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 137 VVIGTYKIHRREDLYP 152 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 139 VVIGTYKIHRREDLYP 154 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 139 VVIGTYKIHRREDLYP 154 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 125 VVIGTYKIHRREDLYP 140 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 125 VVIGTYKIHRREDLYP 140 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 139 VVIGTYKIHRREDLYP 154 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 139 VVIGTYKIHRREDLYP 154 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 137 VVIGTYKIHRREDLYP 152 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 137 VVIGTYKIHRREDLYP 152 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 139 VVIGTYKIHRREDLYP 154 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 139 VVIGTYKIHRREDLYP 154 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 137 VVIGTYKIHRREDLYP 152 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 137 VVIGTYKIHRREDLYP 152 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 124 VVIGTYKIHRREDLYP 139 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 124 VVIGTYKIHRREDLYP 139 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 137 VVIGTYKIHRREDLYP 152 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 137 VVIGTYKIHRREDLYP 152 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 137 VVIGTYKIHRREDLYP 152 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 137 VVIGTYKIHRREDLYP 152 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 138 VVIGTYKIHRREDLYP 153 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 138 VVIGTYKIHRREDLYP 153 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 136 VVIGTYKIHRREDLYP 151 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +1 Query: 79 AFTEEDEKGPPTQPMSQYAPAV-LQTITNPD 168 A ++EDE P QPM P V + T +PD Sbjct: 80 AGSDEDELPQPRQPMGPPVPGVPIMTTPDPD 110 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 31 IVINCYKYHGREDLLP 78 +VI YK H REDL P Sbjct: 100 VVIGTYKIHRREDLYP 115 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 210 DGVVGVHLDEGDAPVGVGDGLQHGGSVLRHG 118 D + V +EGD P G + L H + HG Sbjct: 722 DSLTTVEKEEGDNPDGEEEKLSHEPTPTEHG 752 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 6.8 Identities = 15/55 (27%), Positives = 23/55 (41%) Frame = +1 Query: 229 TTAHVIQSGEGGASVVGALDTDGAVAVDLNAVAEATLNHEGQIILTADDGHGYPV 393 T A I++ +GG + A D+N A L + I++ D G PV Sbjct: 706 TIALTIEAADGGEPPLTAQVEVTVYVQDVNDYAPVFLESQYAIVIPEDTPSGLPV 760 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 23.0 bits (47), Expect = 9.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 18 RSATDCDQLLQVPRK 62 R+A DC + LQ+P K Sbjct: 165 RAAQDCIEFLQIPHK 179 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 90 RRRERTSDTTHVAVRSRRAADHHQPRRE 173 R R+R T+ + RS AA+H R E Sbjct: 302 RARDRMRQTSDLQERSIAAAEHRTARAE 329 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,194 Number of Sequences: 2352 Number of extensions: 11452 Number of successful extensions: 80 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -