BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0233 (677 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 1.7 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 1.7 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 4.0 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 4.0 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 9.3 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 576 ELTLHYDLPADLIQHSVLEKFLGKIIIGK-QDP 671 +LT H L +D + E+F G++ + QDP Sbjct: 277 DLTTHVMLLSDWMHEDATERFPGRLAVNTGQDP 309 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 576 ELTLHYDLPADLIQHSVLEKFLGKIIIGK-QDP 671 +LT H L +D + E+F G++ + QDP Sbjct: 277 DLTTHVMLLSDWMHEDATERFPGRLAVNTGQDP 309 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/35 (22%), Positives = 19/35 (54%) Frame = -3 Query: 621 YAGSNLLVNHNARLIPQQICSLEAVTFRLLLWQFF 517 + GS L+++ ++ + + +TF +W+FF Sbjct: 381 HIGSQLVLHTVKTVLKTTMSTFSDITFMRTVWKFF 415 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 4 YSKRKIVDTIPYFESIILVRSISIE 78 YSK IV T+ YF I++ + E Sbjct: 34 YSKIGIVQTVAYFVIFIILTIVFFE 58 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 70 RYYVLVLCFQNMELCRLFF 14 +YY L +C N+ + +FF Sbjct: 54 KYYWLNVCCLNLSIVTIFF 72 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,738 Number of Sequences: 336 Number of extensions: 3455 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -