BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0232 (398 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 24 1.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 3.1 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 4.1 Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein... 22 7.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 22 9.5 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 24.2 bits (50), Expect = 1.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 Query: 288 PREAWQGRRALHEDTASCGHFSL*RTHPTS 377 P E +GR + D GH S RTH S Sbjct: 112 PEEKLRGRHSSESDREGMGHDSHKRTHRLS 141 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 3.1 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 194 TIFATSSFEISKPSDF-AHTL 135 T+ ++SFE+ KP DF H+L Sbjct: 845 TLTESTSFELKKPKDFRKHSL 865 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.0 bits (47), Expect = 4.1 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +1 Query: 145 AKSEGFEISKDEVAKIVAGFENESLLTSGGVTIAGTRYIYLSGTD 279 A + F + KD + A F E +GG T RY + T+ Sbjct: 180 AAAAEFPLQKDVIRVTNAVFVQEGFPLNGGFTYYSNRYYSSNATN 224 >Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein protein. Length = 192 Score = 22.2 bits (45), Expect = 7.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 299 LARSACIA*RHSKLWSFLSMKNPSNL 376 +A+S CIA + W+ + NP N+ Sbjct: 158 VAKSTCIALTPTGSWTLRNCLNPLNI 183 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 21.8 bits (44), Expect = 9.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 37 KNKTTLKHKIL 5 KNKTTL H+I+ Sbjct: 1466 KNKTTLPHEII 1476 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 448,313 Number of Sequences: 2352 Number of extensions: 8746 Number of successful extensions: 51 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -