BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0223 (348 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 26 0.46 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 24 1.4 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 24 1.4 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 1.9 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 1.9 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 4.3 DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide... 22 5.7 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 22 5.7 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 22 5.7 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 22 5.7 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 22 5.7 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 22 5.7 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 22 5.7 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 22 5.7 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 22 5.7 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 22 5.7 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 22 5.7 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 22 5.7 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 22 5.7 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 22 5.7 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 22 5.7 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 22 5.7 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 22 5.7 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 22 5.7 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 22 5.7 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 22 5.7 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 22 5.7 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 22 5.7 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 22 5.7 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 22 5.7 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 22 5.7 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 22 5.7 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 22 5.7 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 22 5.7 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 22 5.7 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 22 5.7 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 22 5.7 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 22 7.5 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 22 7.5 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 22 7.5 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 22 7.5 AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical prote... 22 7.5 AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosens... 22 7.5 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 22 7.5 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 25.8 bits (54), Expect = 0.46 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 146 GKQASRCPSRRLKWTR--QKPVKCALRSRPPESAILTRIHSPEKILREC 286 G+Q RC SRR K T+ ++ + ALR+ + ++ I E ++ C Sbjct: 297 GRQHDRCDSRRWKTTQFNRQSFRVALRANNFQERAVSHIGMIEALVDAC 345 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 327 LHDSAAFMSQYYRKHSLRIFSGECIRVSMADSG 229 + + A +++Y R H+L +F G +R + SG Sbjct: 233 IDEGQAVVNEYSRLHNLNMFDGVELRNTTRQSG 265 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 327 LHDSAAFMSQYYRKHSLRIFSGECIRVSMADSG 229 + + A +++Y R H+L +F G +R + SG Sbjct: 209 IDEGQAVVNEYSRLHNLNMFDGVELRNTTRQSG 241 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 166 SIEEIE-VDPPKAGEVRVKITATGVCHTDAYTLSGKDPEGV 285 + E+I+ + + ++ K+ G HTD Y+ S K G+ Sbjct: 2253 TFEQIQGISQESSTDIWHKLVDAGYLHTDCYSTSAKKCHGL 2293 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 166 SIEEIE-VDPPKAGEVRVKITATGVCHTDAYTLSGKDPEGV 285 + E+I+ + + ++ K+ G HTD Y+ S K G+ Sbjct: 2254 TFEQIQGISQESSTDIWHKLVDAGYLHTDCYSTSAKKCHGL 2294 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 22.6 bits (46), Expect = 4.3 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -1 Query: 189 VHFNLLDGQRLACF 148 +H +L+G+R+ CF Sbjct: 114 LHMTMLEGKRIGCF 127 >DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide F prepropeptide protein. Length = 234 Score = 22.2 bits (45), Expect = 5.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 161 RCPSRRLKWTRQKP 202 R P++RL+W R P Sbjct: 196 RAPTQRLRWGRSDP 209 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 50 DQDISLYHRLSITTKYYETNIV 71 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 50 DQDISLYHRLSITTKYYETNIV 71 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 52 DQDISLYHRLSITTKYYETNIV 73 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 52 DQDISLYHRLSITTKYYETNIV 73 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 55 DQDISLYHRLSITTKYYETNIV 76 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 55 DQDISLYHRLSITTKYYETNIV 76 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 65 DQDISLYHRLSITTKYYETNIV 86 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 67 DQDISLYHRLSITTKYYETNIV 88 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 67 DQDISLYHRLSITTKYYETNIV 88 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 49 DQDISLYHRLSITTKYYETNIV 70 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 49 DQDISLYHRLSITTKYYETNIV 70 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 9 DSDILLHHRVSAS*LDYNFNIL 74 D DI L+HR+S + Y NI+ Sbjct: 64 DQDISLYHRLSITTKYYETNIV 85 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 190 PPKAGEVRVKIT 225 PPKAGEV + IT Sbjct: 1637 PPKAGEVLIFIT 1648 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 171 DGQRLACFPRDCGQALNHF 115 D QRLA F D G L+H+ Sbjct: 192 DEQRLAYFREDIGVNLHHW 210 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 171 DGQRLACFPRDCGQALNHF 115 D QRLA F D G L+H+ Sbjct: 191 DEQRLAYFREDIGVNLHHW 209 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 21.8 bits (44), Expect = 7.5 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -2 Query: 269 FPESVYASVWQTP 231 FP +YA +W+ P Sbjct: 89 FPHVIYARIWRWP 101 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 21.8 bits (44), Expect = 7.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 177 LLDGQRLACFPRDCGQALNHFTDC 106 L + ++LAC C QA + F +C Sbjct: 244 LQNQKKLACKKSTCQQAYDTFQNC 267 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 21.8 bits (44), Expect = 7.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 177 LLDGQRLACFPRDCGQALNHFTDC 106 L + ++LAC C QA + F +C Sbjct: 244 LQNQKKLACKKSTCQQAYDTFQNC 267 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 21.8 bits (44), Expect = 7.5 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 8/39 (20%) Frame = +2 Query: 179 LKW-TRQKPVKCALRSRPPESA-------ILTRIHSPEK 271 + W TR+ PV A ++ PP +A IL + SP+K Sbjct: 716 VSWGTRENPVDAAKKAPPPVAAPAGKMQKILGYLRSPDK 754 >AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical protein protein. Length = 168 Score = 21.8 bits (44), Expect = 7.5 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +2 Query: 134 PQSRGKQASRCPSRRLKWTRQKPVKCALRSRPPESAILTRIHSP 265 P + +C S + + K +K + +RP + AIL +++ P Sbjct: 67 PDALMSDCVKC-SEKQRIGSDKVIKFIVANRPDDFAILEQLYDP 109 >AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosensory protein CSP3 protein. Length = 168 Score = 21.8 bits (44), Expect = 7.5 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +2 Query: 134 PQSRGKQASRCPSRRLKWTRQKPVKCALRSRPPESAILTRIHSP 265 P + +C S + + K +K + +RP + AIL +++ P Sbjct: 67 PDALMSDCVKC-SEKQRIGSDKVIKFIVANRPDDFAILEQLYDP 109 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 21.8 bits (44), Expect = 7.5 Identities = 22/77 (28%), Positives = 31/77 (40%), Gaps = 10/77 (12%) Frame = -2 Query: 281 PSGSFPESVYASVWQTPVAVILTRTSPAFGGSTSISSM--DS-----GLPASHATAAKHL 123 P+ PESV +++ T T+ + + +ISS D+ L HAT K Sbjct: 654 PAKKEPESVVYPIYRRTTPTTTTTTTASLAPAPAISSRFGDNRPSWRPLIVPHATTTKTP 713 Query: 122 ITLP---TVDMTALDNC 81 T P T T D C Sbjct: 714 TTTPPATTTSTTPRDPC 730 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 357,034 Number of Sequences: 2352 Number of extensions: 7372 Number of successful extensions: 81 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24935070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -