Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Nnor0223
         (348 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   0.78 
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             22   1.8  
M29492-1|AAA27727.1|   74|Apis mellifera protein ( Bee homeobox-...    20   9.6  
DQ435328-1|ABD92643.1|  143|Apis mellifera OBP11 protein.              20   9.6  
AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.              20   9.6  
AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta...    20   9.6  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 23.4 bits (48), Expect = 0.78
 Identities = 7/27 (25%), Positives = 15/27 (55%)
 Frame = +2

Query: 197  KPVKCALRSRPPESAILTRIHSPEKIL 277
            + + C LR+  P   +L  +H+  ++L
Sbjct: 1102 RDLPCVLRASTPAPVVLEAVHASRRVL 1128


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 22.2 bits (45), Expect = 1.8
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -2

Query: 290  GNTPSGSFPESVYASVWQTPVAVILTRTSPAFGGSTS 180
            G   S +F +  +A+   +P   +L R SPAF G++S
Sbjct: 900  GEPTSAAFAQG-FATAASSPG--LLERASPAFSGTSS 933


>M29492-1|AAA27727.1|   74|Apis mellifera protein ( Bee
           homeobox-containing gene,partial cds, clone H40. ).
          Length = 74

 Score = 19.8 bits (39), Expect = 9.6
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +2

Query: 170 SRRLKWTRQKP 202
           +RR KW +Q P
Sbjct: 58  NRRTKWKKQNP 68


>DQ435328-1|ABD92643.1|  143|Apis mellifera OBP11 protein.
          Length = 143

 Score = 19.8 bits (39), Expect = 9.6
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +2

Query: 305 MKAAESWRVSV 337
           MKAAE W VS+
Sbjct: 1   MKAAEIWLVSL 11


>AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.
          Length = 145

 Score = 19.8 bits (39), Expect = 9.6
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -1

Query: 96 CTGQLPITKC 67
          C+G + +TKC
Sbjct: 60 CSGDISVTKC 69


>AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta
          protein precursor protein.
          Length = 145

 Score = 19.8 bits (39), Expect = 9.6
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -1

Query: 96 CTGQLPITKC 67
          C+G + +TKC
Sbjct: 60 CSGDISVTKC 69


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 92,604
Number of Sequences: 438
Number of extensions: 1804
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  7936320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)