BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0218 (538 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 48 3e-07 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 26 0.70 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 4.9 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 23 6.5 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 6.5 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 23 8.6 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 8.6 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 47.6 bits (108), Expect = 3e-07 Identities = 22/61 (36%), Positives = 35/61 (57%) Frame = +3 Query: 351 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQT 530 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++G++L+ AQT Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQT 220 Query: 531 G 533 G Sbjct: 221 G 221 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 26.2 bits (55), Expect = 0.70 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 103 TVVPNLEEATNSAIIRLDLATVAVDLEDLEDLVGKKNSLE 222 T++ +L+E S + LDL +D +L +L +SLE Sbjct: 140 TMLRDLDEGCRSRVQYLDLKLNEIDTVNLAELAASSDSLE 179 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.4 bits (48), Expect = 4.9 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = -2 Query: 249 PNLGDACSDLQRILF----SHQILQILQIYCH 166 P GDA D++ +LF S +I +Q CH Sbjct: 939 PECGDAVEDVEHVLFHCPRSDRIRNEMQQRCH 970 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.0 bits (47), Expect = 6.5 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 157 LATVAVDLEDLEDLVGKKNSLEVRTCVAQIGIL 255 L +A+D+ L+ +GKK +L V + +G + Sbjct: 176 LMAIAIDMNPLKPRMGKKATLCVAASIWIVGTI 208 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 6.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 303 VLKRSPYEVEEYRNNHEVTVSGVEVHNPIQY 395 V++R P V+ + H+V V VH P+ + Sbjct: 139 VVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 22.6 bits (46), Expect = 8.6 Identities = 14/59 (23%), Positives = 23/59 (38%) Frame = +3 Query: 258 SLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQG 434 +++P Y+P P VL + V E + ++ + V EEA Y G Sbjct: 108 TIEPNLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQEEAQIDVYHVDG 166 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 22.6 bits (46), Expect = 8.6 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +3 Query: 357 TVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 464 T S VE + ++EE ++ ++ + T+G K T Sbjct: 266 TASPVEPEEGVDFYEELSYDNHPCKRACTLGRKPET 301 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 486,532 Number of Sequences: 2352 Number of extensions: 8882 Number of successful extensions: 31 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -