BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0215 (445 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 28 3.0 SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 >SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -2 Query: 243 ELLSRLNIMKSIYLKLVKSLNGMKLMRRNSIE 148 +L +RL+ +S+Y +L + N K+MRR I+ Sbjct: 195 DLRNRLSKARSVYTRLKRICNSKKIMRRTKIK 226 >SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 647 Score = 28.3 bits (60), Expect = 3.0 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -2 Query: 243 ELLSRLNIMKSIYLKLVKSLNGMKLMRRNSIE 148 +L +RL+ +S+Y +L + N K+MRR I+ Sbjct: 581 DLRNRLSKARSVYTRLKRIWNSKKIMRRTKIK 612 >SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 28.3 bits (60), Expect = 3.0 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -2 Query: 243 ELLSRLNIMKSIYLKLVKSLNGMKLMRRNSIE 148 +L +RL+ +S+Y +L + N K+MRR I+ Sbjct: 465 DLRNRLSKARSVYTRLKRIWNSKKIMRRTKIK 496 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,527,532 Number of Sequences: 59808 Number of extensions: 192790 Number of successful extensions: 326 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 326 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -