Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Nnor0215
         (445 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g01225.1 68418.m00028 hypothetical protein                          29   1.9  

>At5g01225.1 68418.m00028 hypothetical protein
          Length = 134

 Score = 28.7 bits (61), Expect = 1.9
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 2/41 (4%)
 Frame = -2

Query: 249 KTELLSRLNIMKSIYLKLVKSLNGMKLMRRNSIEP--EMLN 133
           KT   S  N+  S+YL   KSLNG +  R  +IE   E LN
Sbjct: 78  KTTPSSSSNVSSSLYLMKSKSLNGSESHRAEAIEDCIEFLN 118


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,261,549
Number of Sequences: 28952
Number of extensions: 145920
Number of successful extensions: 245
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 245
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 245
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 712739520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)