BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0210 (496 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49310.1 68418.m06102 importin alpha-1 subunit, putative simi... 36 0.020 At5g58980.1 68418.m07389 ceramidase family protein contains Pfam... 34 0.060 At4g16143.1 68417.m02447 importin alpha-2, putative (IMPA-2) sim... 33 0.14 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 32 0.18 At5g40450.1 68418.m04905 expressed protein 30 0.74 At1g07380.1 68414.m00787 ceramidase family protein contains simi... 30 0.74 At5g15560.1 68418.m01822 hypothetical protein 29 1.3 At2g38010.2 68415.m04666 ceramidase family protein contains Pfam... 29 2.3 At2g38010.1 68415.m04665 ceramidase family protein contains Pfam... 29 2.3 At3g06720.2 68416.m00797 importin alpha-1 subunit, putative (IMP... 28 3.0 At3g06720.1 68416.m00796 importin alpha-1 subunit, putative (IMP... 28 3.0 At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family... 28 3.0 At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1)... 28 4.0 At1g65180.1 68414.m07390 DC1 domain-containing protein contains ... 28 4.0 At3g31310.1 68416.m03983 hypothetical protein 27 5.3 At5g52000.1 68418.m06453 importin alpha-1 subunit, putative simi... 27 6.9 At1g26360.1 68414.m03216 hydrolase, alpha/beta fold family prote... 27 6.9 At3g08010.1 68416.m00978 expressed protein 27 9.2 At1g47900.1 68414.m05334 expressed protein 27 9.2 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 27 9.2 At1g02690.2 68414.m00220 importin alpha-2 subunit, putative simi... 27 9.2 At1g02690.1 68414.m00219 importin alpha-2 subunit, putative simi... 27 9.2 >At5g49310.1 68418.m06102 importin alpha-1 subunit, putative similar to importin alpha-1 subunit (Karyopherin alpha-1 subunit, KAP alpha) [Arabidopsis thaliana] SWISS-PROT:Q96321 Length = 519 Score = 35.5 bits (78), Expect = 0.020 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = -1 Query: 205 LVQHSQRAKQVVIVPAVRSFGNIKTAFTEETECV 104 LV+ Q A VV+VPA+R GNI + +++T CV Sbjct: 287 LVELLQHASPVVLVPALRCIGNIVSGNSQQTHCV 320 >At5g58980.1 68418.m07389 ceramidase family protein contains Pfam domain, PF04734: Neutral/alkaline nonlysosomal ceramidase Length = 733 Score = 33.9 bits (74), Expect = 0.060 Identities = 19/84 (22%), Positives = 42/84 (50%) Frame = +2 Query: 173 HLFSSLGMLHECSPSMMSTADKSFYGTHEQCQSNEDIFNCEEEIDENLERAPTSMLPDED 352 +L +SLG +H+ +++ ++S HE + + N E +D + R+P++ L + Sbjct: 134 YLVTSLGFVHQSFNALVDGIEQSIIQAHENLRPGSILINKGELLDAGVNRSPSAYL---N 190 Query: 353 DPLSPENLVQDNVKHFCRLMKFAN 424 +P + + +V L+KF + Sbjct: 191 NPAHERSKYEYDVDKEMTLVKFVD 214 >At4g16143.1 68417.m02447 importin alpha-2, putative (IMPA-2) similar to importin alpha 2 [Capsicum annuum] GI:13752562; contains Pfam profiles PF01749: Importin beta binding domain, PF00514: Armadillo/beta-catenin-like repeat; non-consensus GG donor splice site at exon 1 and 6; CT acceptor splice site at exon 2 Length = 444 Score = 32.7 bits (71), Expect = 0.14 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 205 LVQHSQRAKQVVIVPAVRSFGNIKTAFTEETECVPS 98 LV+ Q V++PA+RS GNI T +T+CV S Sbjct: 294 LVELLQHQSPSVLIPALRSIGNIVTGDDLQTQCVIS 329 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 32.3 bits (70), Expect = 0.18 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +2 Query: 194 MLHECSPSMMSTADKSFYGTHEQCQSNEDIFNCEEEIDENLERAPTSMLPDEDDPLSPE 370 M H SPS + DKS G EQ + + N + ++L++ + DEDD P+ Sbjct: 390 MEHATSPSFSGSRDKSGKGHLEQKDRSSPVRNVKAPAAQSLKKRRAVCIYDEDDDEDPK 448 >At5g40450.1 68418.m04905 expressed protein Length = 2910 Score = 30.3 bits (65), Expect = 0.74 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 275 EDIFNCEEEIDENLERAPTSMLPD-EDDPLSPE 370 EDIF+ E E+ AP SML ED+P++P+ Sbjct: 2103 EDIFSTETVPKESFIEAPVSMLASGEDEPVTPQ 2135 >At1g07380.1 68414.m00787 ceramidase family protein contains similarity to mitochondrial ceramidase [Homo sapiens] gi|9246993|gb|AAF86240 Length = 779 Score = 30.3 bits (65), Expect = 0.74 Identities = 18/84 (21%), Positives = 39/84 (46%) Frame = +2 Query: 173 HLFSSLGMLHECSPSMMSTADKSFYGTHEQCQSNEDIFNCEEEIDENLERAPTSMLPDED 352 ++ +SLG + + +++ + S HE + N E +D + R+P++ L + Sbjct: 142 YIVTSLGFVRQSFDALVDGIENSIIQAHENLRPGSIFLNNGELLDAGVNRSPSAYL---N 198 Query: 353 DPLSPENLVQDNVKHFCRLMKFAN 424 +P + + NV L+KF + Sbjct: 199 NPSKERSKHKYNVDKEMTLLKFVD 222 >At5g15560.1 68418.m01822 hypothetical protein Length = 239 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/66 (25%), Positives = 29/66 (43%) Frame = +2 Query: 284 FNCEEEIDENLERAPTSMLPDEDDPLSPENLVQDNVKHFCRLMKFANGHSPALYFSMDPE 463 FN +E+ N+ EDD + ++QD++ CR N S + + E Sbjct: 70 FNSKEQDISNVTSKQKDKATTEDDDDDVKEIIQDDISICCRSEASNNSISSFTFPILHNE 129 Query: 464 EERNVT 481 E+ +VT Sbjct: 130 EDESVT 135 >At2g38010.2 68415.m04666 ceramidase family protein contains Pfam domain, PF04734: Neutral/alkaline nonlysosomal ceramidase Length = 792 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/84 (20%), Positives = 41/84 (48%) Frame = +2 Query: 173 HLFSSLGMLHECSPSMMSTADKSFYGTHEQCQSNEDIFNCEEEIDENLERAPTSMLPDED 352 ++ +SLG + + +++ ++S HE + N + +D + R+P+S L + Sbjct: 131 YIVTSLGFVRQSFDVVVNGIEQSIVQAHESLRPGSAFVNKGDLLDAGVNRSPSSYL---N 187 Query: 353 DPLSPENLVQDNVKHFCRLMKFAN 424 +P + + + +V L+KF + Sbjct: 188 NPAAERSKYKYDVDKEMTLVKFVD 211 >At2g38010.1 68415.m04665 ceramidase family protein contains Pfam domain, PF04734: Neutral/alkaline nonlysosomal ceramidase Length = 757 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/84 (20%), Positives = 41/84 (48%) Frame = +2 Query: 173 HLFSSLGMLHECSPSMMSTADKSFYGTHEQCQSNEDIFNCEEEIDENLERAPTSMLPDED 352 ++ +SLG + + +++ ++S HE + N + +D + R+P+S L + Sbjct: 131 YIVTSLGFVRQSFDVVVNGIEQSIVQAHESLRPGSAFVNKGDLLDAGVNRSPSSYL---N 187 Query: 353 DPLSPENLVQDNVKHFCRLMKFAN 424 +P + + + +V L+KF + Sbjct: 188 NPAAERSKYKYDVDKEMTLVKFVD 211 >At3g06720.2 68416.m00797 importin alpha-1 subunit, putative (IMPA1) similar to importin alpha-1 subunit (Karyopherin alpha-1 subunit, KAP alpha) [Arabidopsis thaliana] SWISS-PROT:Q96321 Length = 532 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 172 VIVPAVRSFGNIKTAFTEETECV 104 V++PA+R+ GNI T +T+CV Sbjct: 300 VLIPALRTVGNIVTGDDIQTQCV 322 >At3g06720.1 68416.m00796 importin alpha-1 subunit, putative (IMPA1) similar to importin alpha-1 subunit (Karyopherin alpha-1 subunit, KAP alpha) [Arabidopsis thaliana] SWISS-PROT:Q96321 Length = 532 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 172 VIVPAVRSFGNIKTAFTEETECV 104 V++PA+R+ GNI T +T+CV Sbjct: 300 VLIPALRTVGNIVTGDDIQTQCV 322 >At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family protein similar to SP|Q28141 ATP-dependent RNA helicase A (Nuclear DNA helicase II) (DEAD-box protein 9) {Bos taurus}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 1015 Score = 28.3 bits (60), Expect = 3.0 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 9/77 (11%) Frame = +2 Query: 185 SLGMLHECSPSMMSTADK--SFYGTHE-------QCQSNEDIFNCEEEIDENLERAPTSM 337 +L H P +S++D ++Y +E +CQ +ED + E++D N + P + Sbjct: 616 TLSSFHRFRPQFISSSDSQPTYYNPYEFDHTCYIECQPSEDKYLHSEDVDNN--QPPPEV 673 Query: 338 LPDEDDPLSPENLVQDN 388 P P N Q N Sbjct: 674 RKCVSVPFVPPNAFQAN 690 >At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1) (FAS1) identical to FAS1 [Arabidopsis thaliana] GI:4887626 Length = 815 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 257 EQCQSNEDIFNCEEEIDENLERAPTSMLPDEDD 355 E+ ++ E + +CE++ DE+LE S DEDD Sbjct: 527 EEEEAGESLSDCEKDEDESLEEG-CSKADDEDD 558 >At1g65180.1 68414.m07390 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 653 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 254 HEQCQSNEDIFNCEEEIDENLERAPTSMLPDEDDPLSPENLVQDN-VKHFCRL 409 H +C + ED+++ E DE P+ED+P+ P ++ + ++HF + Sbjct: 331 HTKCATREDVWDGIEMKDE----------PEEDEPMEPFEVISEGIIRHFSHI 373 >At3g31310.1 68416.m03983 hypothetical protein Length = 291 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +2 Query: 275 EDIFNCEEEIDENLERAPTSMLPDEDDPLSPENLVQDNVKHFCR 406 ED+ C++ NL A S+L D L L D HF R Sbjct: 185 EDLLLCDKAASANLIGACASLLLPPPDTLLEFELYADTASHFLR 228 >At5g52000.1 68418.m06453 importin alpha-1 subunit, putative similar to importin alpha-1 subunit (Karyopherin alpha-1 subunit, KAP alpha) [Arabidopsis thaliana] SWISS-PROT:Q96321 Length = 441 Score = 27.1 bits (57), Expect = 6.9 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 205 LVQHSQRAKQVVIVPAVRSFGNIKTAFTEETECV 104 LVQ Q VV+VPA+ + G + ++T+CV Sbjct: 217 LVQILQLPSPVVLVPALLTIGAMTAGNHQQTQCV 250 >At1g26360.1 68414.m03216 hydrolase, alpha/beta fold family protein similar to SP|Q40708 PIR7A protein {Oryza sativa}, ethylene-induced esterase [Citrus sinensis] GI:14279437, polyneuridine aldehyde esterase [Rauvolfia serpentina] GI:6651393; contains Pfam profile PF00561: alpha/beta hydrolase fold Length = 444 Score = 27.1 bits (57), Expect = 6.9 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 284 KYLRSTDTVRGFRRNFCLPSTSCWG 210 KY+R + FRR LPS SC G Sbjct: 31 KYVRRLSLMPSFRRRTLLPSLSCSG 55 >At3g08010.1 68416.m00978 expressed protein Length = 374 Score = 26.6 bits (56), Expect = 9.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 170 HHLFSSLGMLHECSPSMMSTADKSFYGTHEQCQSNE 277 HHLFSS +L C S + S T EQ +NE Sbjct: 32 HHLFSSETLLKRCRFVSRSLPESSLSITKEQEVANE 67 >At1g47900.1 68414.m05334 expressed protein Length = 1054 Score = 26.6 bits (56), Expect = 9.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 257 EQCQSNEDIFNCEEEIDENLERAPTSMLPDEDD 355 E+C E I C E++E+++R + L EDD Sbjct: 883 EKCNHQEAILRC-HELEEHIQRHRNTSLVAEDD 914 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 26.6 bits (56), Expect = 9.2 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +3 Query: 198 CTSAAPA*CRRQTKVSTEPTNSVSRTKIFLIV 293 CTS P R + ++++ PT S S ++F ++ Sbjct: 6 CTSRPPISIRSEMRIASSPTGSFSTRQMFSVL 37 >At1g02690.2 68414.m00220 importin alpha-2 subunit, putative similar to importin alpha-2 subunit (Karyopherin alpha-2 subunit) (KAP alpha) SP:O04294 from [Arabidopsis thaliana] Length = 539 Score = 26.6 bits (56), Expect = 9.2 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 205 LVQHSQRAKQVVIVPAVRSFGNIKTAFTEETECVPS 98 LVQ V++PA+R+ GNI T +T+ V S Sbjct: 294 LVQLLAHPSPSVLIPALRTIGNIVTGDDIQTQAVIS 329 >At1g02690.1 68414.m00219 importin alpha-2 subunit, putative similar to importin alpha-2 subunit (Karyopherin alpha-2 subunit) (KAP alpha) SP:O04294 from [Arabidopsis thaliana] Length = 538 Score = 26.6 bits (56), Expect = 9.2 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 205 LVQHSQRAKQVVIVPAVRSFGNIKTAFTEETECVPS 98 LVQ V++PA+R+ GNI T +T+ V S Sbjct: 293 LVQLLAHPSPSVLIPALRTIGNIVTGDDIQTQAVIS 328 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,192,208 Number of Sequences: 28952 Number of extensions: 201721 Number of successful extensions: 625 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 868578304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -