BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0202 (403 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 3e-32 SB_29195| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.022 SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.61 SB_28048| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_35869| Best HMM Match : Piwi (HMM E-Value=4.6e-12) 27 4.3 SB_17254| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_9028| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_49442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_19075| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_11967| Best HMM Match : Pollen_allerg_2 (HMM E-Value=1.7) 27 5.7 SB_1787| Best HMM Match : Peptidase_S9 (HMM E-Value=1.5e-08) 27 5.7 SB_45205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_45201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_32767| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_31221| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_59599| Best HMM Match : rve (HMM E-Value=1.69557e-43) 26 10.0 SB_16139| Best HMM Match : rve (HMM E-Value=3.6e-21) 26 10.0 SB_671| Best HMM Match : Pneumo_matrix (HMM E-Value=3.9) 26 10.0 >SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 134 bits (324), Expect = 3e-32 Identities = 61/92 (66%), Positives = 71/92 (77%), Gaps = 1/92 (1%) Frame = +3 Query: 66 VFFEEKFPDDSWESNWVYSEHPGKEFGKFKLTAGKFFSDPEDDKGLKTSEDARFYALSRK 245 V F EKF D SWE WV S G + GKFK TAGKF+ D E DKG++TSEDA+FY +S K Sbjct: 756 VHFLEKFEDKSWEDRWVSSTSKGAQQGKFKWTAGKFYGDAEADKGIQTSEDAKFYGISAK 815 Query: 246 F-KPFSNEGKPLVVQFTVKHEQDIDCGGGYLK 338 F KPF+NEGK LV+QF+VKHEQ+IDCGGGY K Sbjct: 816 FEKPFTNEGKTLVIQFSVKHEQNIDCGGGYAK 847 >SB_29195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 35.1 bits (77), Expect = 0.022 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 3/98 (3%) Frame = -1 Query: 325 PPQSMSCSCLTVNXTTKGLPSLLNG---LNLRERA*NLASSEVFKPLSSSGSLKNFPAVN 155 P + SC CL V T GLP L++G L R L+ + P S SL + V Sbjct: 429 PSEQNSCQCLFVGWQTVGLPQLIHGTVALISFRRKRTLSGGSL--PRGRSRSLSS-DRVG 485 Query: 154 LNFPNSFPGCSLYTQLLSHESSGNFSSKNTSQFIEDNA 41 P++ G + + S+G+ S+ +SQ D A Sbjct: 486 TRLPSARKGSASKIGIPRTSSTGSLGSRRSSQSSTDGA 523 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 30.3 bits (65), Expect = 0.61 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 283 TTKGLPSLLNGLNLRERA*NLASSEVFKPLSSSGSLKNF 167 TT+GLPS ++ +NL E NL S KP S + ++ Sbjct: 960 TTQGLPSKISSVNLTEALSNLISISWSKPSDGSSLITDY 998 >SB_28048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.7 bits (61), Expect = 1.9 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -3 Query: 128 VLTVHPIAFPRIIRKLLLKEYI 63 +LT H + P++IRK+ LK+Y+ Sbjct: 73 LLTAHLVVAPKLIRKMPLKDYV 94 >SB_35869| Best HMM Match : Piwi (HMM E-Value=4.6e-12) Length = 243 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 352 LQSKTLRYPPPQSMSCSCLTVNXTTKGLPSLL 257 +Q K + P PQ++S CL +N G+ ++L Sbjct: 9 IQGKNVTKPSPQTLSNLCLKINAKLGGVNNIL 40 >SB_17254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 352 LQSKTLRYPPPQSMSCSCLTVNXTTKGLPSLL 257 +Q K + P PQ++S CL +N G+ ++L Sbjct: 9 IQGKNVTKPSPQTLSNLCLKINAKLGGVNNIL 40 >SB_9028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 5.7 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 4/23 (17%) Frame = -2 Query: 135 FLGAHCTPNCFPT----NHQETS 79 F+ C PNC PT NHQ TS Sbjct: 20 FINHSCEPNCIPTRVFVNHQPTS 42 >SB_49442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 914 Score = 27.1 bits (57), Expect = 5.7 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 207 TSEDARFYALSRKFK--PFSNEGKPLVVQFTVKHEQDIDCG 323 T +D R Y R F+ PF++ + ++ KH+++I+CG Sbjct: 870 TPQDNRHYVYFRDFQRDPFASLDMSELYKWINKHKKNIECG 910 >SB_19075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6500 Score = 27.1 bits (57), Expect = 5.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 166 PAVNLNFPNSFPGCSLYTQLLS 101 P+V LNF N+FPG L + +S Sbjct: 6188 PSVELNFRNTFPGDDLLKRYIS 6209 >SB_11967| Best HMM Match : Pollen_allerg_2 (HMM E-Value=1.7) Length = 1815 Score = 27.1 bits (57), Expect = 5.7 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +3 Query: 180 DPEDDKGLKTSEDARFYALSRKFKPFSNEGKPLVVQFTV 296 D D KTSE AL K K E + +VVQFT+ Sbjct: 912 DSADILSRKTSEAVLESALESKTKELLVESRQMVVQFTI 950 >SB_1787| Best HMM Match : Peptidase_S9 (HMM E-Value=1.5e-08) Length = 1057 Score = 27.1 bits (57), Expect = 5.7 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = -1 Query: 202 KPLSSSGSLKNFPAVNLNFPNSFPGCSLYTQLLSHESSGNFSSKNTSQFIEDNAS 38 KPL G L + +N P+S PG + + LS + SS++ +F D AS Sbjct: 980 KPLEGPGLLNTLAVLGMNSPSSRPGANDTSADLS-----SLSSQDEQEFQRDLAS 1029 >SB_45205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 329 Score = 26.6 bits (56), Expect = 7.6 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 3/67 (4%) Frame = +3 Query: 201 LKTSEDARFYALSRKFKPFSNEGK---PLVVQFTVKHEQDIDCGGGYLKVFDCKLEQKDM 371 L+T + Y + FS GK LV+ K + DCG Y D K + Sbjct: 181 LRTHTGQKPYKCDECGECFSESGKLKRHLVIHTGEKPHKCDDCGKRYTLSGDLKTHLRIH 240 Query: 372 HGETPYE 392 GE PYE Sbjct: 241 TGEKPYE 247 >SB_45201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 26.6 bits (56), Expect = 7.6 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 3/67 (4%) Frame = +3 Query: 201 LKTSEDARFYALSRKFKPFSNEGK---PLVVQFTVKHEQDIDCGGGYLKVFDCKLEQKDM 371 L+T + Y + FS GK LV+ K + DCG Y D K + Sbjct: 181 LRTHTGQKPYKCDECGECFSESGKLKRHLVIHTGEKPHKCDDCGKRYTLSGDLKTHLRIH 240 Query: 372 HGETPYE 392 GE PYE Sbjct: 241 TGEKPYE 247 >SB_32767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1259 Score = 26.6 bits (56), Expect = 7.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 268 PSLLNGLNLRERA*NLASSEVFKPLSSSGSLKNFPAVN 155 P+ NG+N+RE L +++ + L G + F A N Sbjct: 909 PNNPNGMNIREECAKLVLADIVEWLKDKGKVAIFDATN 946 >SB_31221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 26.6 bits (56), Expect = 7.6 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 361 CSSLQSKTLRYPPPQSMSCSCLTVNXTTKGLPSLLNGLNLRER 233 C+S K Y P +CS + T L LLN L+L+++ Sbjct: 190 CTSEPFKEFFYLPDLKQACSDIRGGKFTDALSLLLNALHLQQK 232 >SB_59599| Best HMM Match : rve (HMM E-Value=1.69557e-43) Length = 1803 Score = 26.2 bits (55), Expect = 10.0 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 63 DVFFEEKFPDDSWESNWVYSEHP 131 DV+ K PD +W ++W ++P Sbjct: 871 DVWIYHKVPDPNWYASWADKDNP 893 >SB_16139| Best HMM Match : rve (HMM E-Value=3.6e-21) Length = 889 Score = 26.2 bits (55), Expect = 10.0 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 63 DVFFEEKFPDDSWESNWVYSEHP 131 DV+ K PD +W ++W ++P Sbjct: 672 DVWIYHKVPDPNWYASWADKDNP 694 >SB_671| Best HMM Match : Pneumo_matrix (HMM E-Value=3.9) Length = 907 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 139 SFPGCSLYTQLLSHESSGNFSSKNTSQFIEDNASKLTTTSTT 14 S P C L T H + G +S ++ Q +K TTST+ Sbjct: 235 SHPWCVLDTTRHPHHTRGTYSIQHDIQITPVEDTKYNTTSTS 276 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,000,635 Number of Sequences: 59808 Number of extensions: 268152 Number of successful extensions: 703 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 715479706 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -