BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0183 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces... 27 2.0 SPBC56F2.07c |||AAA family ATPase, unknown biological role|Schiz... 27 3.5 SPAC24H6.10c |||phospho-2-dehydro-3-deoxyheptonate aldolase |Sch... 27 3.5 >SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 3699 Score = 27.5 bits (58), Expect = 2.0 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 255 ETRKQILAQLFCRGLYELQKEITHVCVTYINHVTVQS 365 +TR +I+A +F + LY KEI V + + HV Q+ Sbjct: 1396 QTRTKIIA-IFFKDLYSPHKEIYSVAIDALRHVLSQN 1431 >SPBC56F2.07c |||AAA family ATPase, unknown biological role|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 26.6 bits (56), Expect = 3.5 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 374 GLSTLHSNMI--DVCNAHMGNFLLQLIKATTKQLC*YLLS 261 GL +H ++ ++C AH LL L KA T+ + Y S Sbjct: 761 GLIAMHEDLEAKEICQAHFKTALLALRKAITRDMLEYYAS 800 >SPAC24H6.10c |||phospho-2-dehydro-3-deoxyheptonate aldolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 368 Score = 26.6 bits (56), Expect = 3.5 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 310 KRKLPMCALHTSIMLLCKVDNPSSNYKNK 396 K KL C SIM+ C N S N+KN+ Sbjct: 265 KAKLEECNKLPSIMIDCSHGNSSKNHKNQ 293 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,841,399 Number of Sequences: 5004 Number of extensions: 56105 Number of successful extensions: 87 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -