BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0183 (717 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0598 + 19858004-19858192,19858295-19858926,19859001-198590... 29 4.9 >07_03_0598 + 19858004-19858192,19858295-19858926,19859001-19859057, 19859159-19859397,19859903-19860097,19860140-19860226, 19861086-19861201 Length = 504 Score = 28.7 bits (61), Expect = 4.9 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +1 Query: 25 HDGWR--HLRLHFTLSIGSGNHLTSGGS*THPPTKAINNNNLKMAK*DRHEQWQTQNLVS 198 HD WR H +F + N L GG+ T P +A+ N N + + ++ T NLVS Sbjct: 443 HD-WRDAHPNTYFNMD-HIQNRLEQGGTVTAFPCRAVENTNSSKGRRQQSKRQATINLVS 500 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,755,516 Number of Sequences: 37544 Number of extensions: 338224 Number of successful extensions: 549 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -