BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0179 (890 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.05 |||oligosaccharyltransferase epsilon subunit |Schizos... 29 1.2 SPAPB8E5.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 2.7 SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 27 3.6 SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces pom... 27 4.7 SPAC1142.05 |ctr5||copper transporter complex subunit Ctr5 |Schi... 26 6.3 SPAC22G7.07c |||mRNA |Schizosaccharomyces pombe|chr 1|||Manual 26 6.3 SPAC56F8.10 |met9|met5|methylenetetrahydrofolate reductase Met9|... 26 8.3 SPCC11E10.07c |||translation initiation factor eIF2B alpha subun... 26 8.3 >SPAC6F6.05 |||oligosaccharyltransferase epsilon subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 122 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +2 Query: 137 SYNADADIGMLVTGTFVGYLIIFAGAAAGYIMQT---PSHKRIDIFYSLVG 280 SYN + ++ + F+G+L++ G GY + P + + F S VG Sbjct: 17 SYNENTNLSLKTIDAFLGFLVVVGGLQFGYALLVGTYPFNSFLSGFISCVG 67 >SPAPB8E5.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 103 Score = 27.5 bits (58), Expect = 2.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 524 SNPNKTALYLYAAFEILF*LCSSILCT*FSL 432 SNPNK ++Y+Y F LCS L SL Sbjct: 72 SNPNKFSIYIYIYFFFYSFLCSPYLFKYISL 102 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 27.1 bits (57), Expect = 3.6 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 485 MLHTNTMLSY*DYYGPPNNVNSTAITVT 568 ++HTNT +S P N N+T +++T Sbjct: 95 LIHTNTSISKPSQTATPQNTNTTQVSLT 122 >SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1125 Score = 26.6 bits (56), Expect = 4.7 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = -2 Query: 211 TSEYDEVPDKGTGDEHANIRICIVTVVMESDARTRKCQLQKLDDRQPADGHDS 53 ++E +V + G+ D+ NIR +V V E+D RT Q K + +PA D+ Sbjct: 17 SAEQLDVVESGSIDQQ-NIRAWVVRKVKENDKRTSTNQSFKWEAVKPASCLDA 68 >SPAC1142.05 |ctr5||copper transporter complex subunit Ctr5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 173 Score = 26.2 bits (55), Expect = 6.3 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +2 Query: 122 ALHYHSYNADADIGMLVTGTFVGYLII--FAGAAAGYIM 232 A Y S+ A I ML+ +F GY I+ F GA G+ + Sbjct: 116 AAMYSSFYLSATILMLIVMSFNGYAILFGFVGAWIGFFL 154 >SPAC22G7.07c |||mRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 413 Score = 26.2 bits (55), Expect = 6.3 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 193 VPDKGTGDEHANIRICIVTVVMESDARTRKC-QLQKLDDRQPAD 65 +P+K T D + N V V++S R R+ QL+ LDD Q D Sbjct: 34 LPEKSTSD-YENSGKGTVGQVLQSLQRVRRALQLRSLDDNQSTD 76 >SPAC56F8.10 |met9|met5|methylenetetrahydrofolate reductase Met9|Schizosaccharomyces pombe|chr 1|||Manual Length = 603 Score = 25.8 bits (54), Expect = 8.3 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -2 Query: 319 VNNNGTASDEQGNTDQRI-EDVDPFV*RSLHYVARGRTSEYDEVPDKGTGDEHA 161 V+ N + D+RI E V P R+ + RT ++DE+P GD + Sbjct: 302 VDTNNVELTNASSQDRRINEGVRPIFWRTRNESYVSRTDQWDELPHGRWGDSRS 355 >SPCC11E10.07c |||translation initiation factor eIF2B alpha subunit|Schizosaccharomyces pombe|chr 3|||Manual Length = 341 Score = 25.8 bits (54), Expect = 8.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 205 RWCGRGLHNADSFTQTDRHLLFAGRCCLVRR*RC 306 R+ R LH+ F Q RHL+ G+ + R C Sbjct: 88 RFVTRSLHDVGDFEQCKRHLVENGKLFIQRARAC 121 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,769,285 Number of Sequences: 5004 Number of extensions: 52443 Number of successful extensions: 142 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -