BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0179 (890 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.6 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 3.7 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 3.7 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 23 4.9 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 23 4.9 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.2 bits (50), Expect = 1.6 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +2 Query: 305 AIIIDRFQHYGKSEIKDKNLAKASLAIINGAILLVDAVLTQRG 433 A+ I + H + + + K LAK + +G ++ V+ +L Q+G Sbjct: 1095 AVQIQQSPHQQQQQQQQKILAKVLTSSNSGQLISVENLLAQKG 1137 Score = 21.8 bits (44), Expect = 8.6 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -3 Query: 186 TKVPVTSMPISASAL 142 T VP+TS+P S++++ Sbjct: 852 TTVPITSLPASSTSI 866 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.0 bits (47), Expect = 3.7 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 9 STCLAIIIIKFK-FRSESWPSAGCLSSSFW 95 S CL ++ + F S SW + L SFW Sbjct: 293 SGCLQFLVPMLQGFPSNSWVAINELQDSFW 322 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.0 bits (47), Expect = 3.7 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 9 STCLAIIIIKFK-FRSESWPSAGCLSSSFW 95 S CL ++ + F S SW + L SFW Sbjct: 261 SGCLQFLVPMLQGFPSNSWVAINELQDSFW 290 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 22.6 bits (46), Expect = 4.9 Identities = 10/32 (31%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +1 Query: 442 YVHKIELHNQKRISNAA-YKYNAVLLGLLWSA 534 Y+ ++ L +Q++ S YK+N +L +LW++ Sbjct: 76 YIIRMFLISQQKTSKLKIYKWNNQILHILWTS 107 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 22.6 bits (46), Expect = 4.9 Identities = 10/32 (31%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +1 Query: 442 YVHKIELHNQKRISNAA-YKYNAVLLGLLWSA 534 Y+ ++ L +Q++ S YK+N +L +LW++ Sbjct: 59 YIIRMFLISQQKTSKLKIYKWNNQILHILWTS 90 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,548 Number of Sequences: 438 Number of extensions: 3870 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28783482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -