BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0179 (890 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28680.1 68417.m04098 tyrosine decarboxylase, putative simila... 28 9.6 At3g23840.1 68416.m02997 transferase family protein low similari... 28 9.6 >At4g28680.1 68417.m04098 tyrosine decarboxylase, putative similar to SP|P54768 Tyrosine/DOPA decarboxylase 1 [Includes: DOPA decarboxylase (EC 4.1.1.28) (DDC); Tyrosine decarboxylase (EC 4.1.1.25)] {Papaver somniferum}, SP|Q06086 Tyrosine decarboxylase 2 (EC 4.1.1.25) {Petroselinum crispum}; contains Pfam profile PF00282: Pyridoxal-dependent decarboxylase conserved domain Length = 545 Score = 27.9 bits (59), Expect = 9.6 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = +1 Query: 127 PLPQLQCRCGYW-HARHRYL---CRVPHHIRWCGRGLHNADSFTQTDRHLLFAGRCC 285 PL + + G W H Y C P + ++ G+ NADSF LFA + C Sbjct: 314 PLGNIAKKYGIWLHVDAAYAGNACICPEYRKFID-GIENADSFNMNAHKWLFANQTC 369 >At3g23840.1 68416.m02997 transferase family protein low similarity to hypersensitivity-related gene [Nicotiana tabacum] GI:1171577, acetyl-CoA:benzylalcohol acetyltranferase [Clarkia concinna] GI:6166330; contains Pfam profile PF02458: Transferase family Length = 420 Score = 27.9 bits (59), Expect = 9.6 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = -2 Query: 427 LREDSINK*DSAIDDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQGNTDQRIEDVDPF 248 +R D A+ +GQ S + F +A + E V + G A DE+ D+ ++DV F Sbjct: 279 IRSDPKKLKPRAVRNGQMISSIHVDFSVAEASLEEIVKSIGEAKDERVVIDEIVDDVSDF 338 Query: 247 V 245 + Sbjct: 339 I 339 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,613,863 Number of Sequences: 28952 Number of extensions: 276907 Number of successful extensions: 674 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2090971320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -