BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0177 (354 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4... 30 0.091 SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces p... 25 2.6 SPBC365.12c |ish1||LEA domain protein|Schizosaccharomyces pombe|... 25 4.5 SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces pom... 24 6.0 SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||M... 24 7.9 SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosac... 24 7.9 SPCC18.08 |||lysine-tRNA ligase|Schizosaccharomyces pombe|chr 3|... 24 7.9 >SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4|Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 30.3 bits (65), Expect = 0.091 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 165 VRVHRANTGRSSNELDRQTTELERR 239 +R H+ + GR+ ELDR+ T+L++R Sbjct: 18 LRAHQRSLGRAERELDRERTKLDQR 42 >SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 25.4 bits (53), Expect = 2.6 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -1 Query: 168 GLTNVSMSQMQGQVDYDFGVGGGVPIV--RCEERVDHE 61 G ++ S+S ++ ++DY G+P+V + E VD E Sbjct: 11 GKSDTSVSSLECEIDYHIEGSDGIPVVEPKISEFVDME 48 >SPBC365.12c |ish1||LEA domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 684 Score = 24.6 bits (51), Expect = 4.5 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 166 SESTVRIQADLQMNWIDKRLSWNAGEWGCSTWLVSSERLWRPDV 297 S +++R A + + + +L N G+W TW + R W DV Sbjct: 160 SPASLRETAAKEYDALTSKLG-NTGDWIYDTWSDNELRTWLHDV 202 >SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1125 Score = 24.2 bits (50), Expect = 6.0 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 154 NIRESESTVRIQADLQMNWIDKRLSW 231 N ES S +++Q+D + + D R++W Sbjct: 526 NESESNSLLKLQSDFKFSNSDDRVAW 551 >SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||Manual Length = 342 Score = 23.8 bits (49), Expect = 7.9 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 234 VPTQSFVDPIHLKICLYSHGGL 169 +P Q+F H+++C+Y GG+ Sbjct: 153 IPQQNFT---HVRLCMYPDGGI 171 >SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 23.8 bits (49), Expect = 7.9 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = +1 Query: 196 LQMNWIDKRLSWNAGEWGCSTWLVSSERLWRPDVVLL---NAAATTDGDY 336 L +N ++WNAG G + +ER PD V L + AA D D+ Sbjct: 40 LSVNPFYLSVNWNAGAGGALAVIPLNERGKLPDQVNLFRGHTAAVLDTDW 89 >SPCC18.08 |||lysine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 531 Score = 23.8 bits (49), Expect = 7.9 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 13 CAIASAAECENATSLSLMIDSLLATYDRDSPPDSKIVVN 129 C I C A L + DSL+ Y+ SP K V+N Sbjct: 378 CEIMLPKTCTVAHLLDKLFDSLVLKYNTSSP---KFVIN 413 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,461,568 Number of Sequences: 5004 Number of extensions: 28871 Number of successful extensions: 102 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 105935336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -