BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0175 (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25352| Best HMM Match : W2 (HMM E-Value=9.1e-20) 144 7e-35 SB_42832| Best HMM Match : ShTK (HMM E-Value=4.6e-07) 31 0.62 SB_51904| Best HMM Match : CH (HMM E-Value=0.0058) 31 1.1 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 30 1.9 SB_23284| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_59343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_57496| Best HMM Match : TSP_1 (HMM E-Value=3.2e-13) 29 2.5 SB_44951| Best HMM Match : TSP_1 (HMM E-Value=3.2e-13) 29 2.5 SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_40901| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_33131| Best HMM Match : DUF1168 (HMM E-Value=1.7e-06) 29 3.3 SB_16907| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_7955| Best HMM Match : SH3_1 (HMM E-Value=0.77) 29 3.3 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 29 4.4 SB_56651| Best HMM Match : DUF496 (HMM E-Value=8.5) 28 5.8 SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_10566| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_40530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_39891| Best HMM Match : Seryl_tRNA_N (HMM E-Value=0.11) 28 5.8 SB_2798| Best HMM Match : DNA_pol_B_2 (HMM E-Value=7.9e-10) 28 5.8 SB_4026| Best HMM Match : MSSP (HMM E-Value=1.3) 28 7.7 SB_9776| Best HMM Match : 7tm_1 (HMM E-Value=8.2e-08) 28 7.7 >SB_25352| Best HMM Match : W2 (HMM E-Value=9.1e-20) Length = 457 Score = 144 bits (348), Expect = 7e-35 Identities = 74/147 (50%), Positives = 99/147 (67%), Gaps = 6/147 (4%) Frame = +1 Query: 109 EKEKYDPNGFRDALVQGLERA---GGDLDAAYKYLDSAGSKLDYRRYGEVIFDVLIAGGL 279 EKEK+ P GFRDA++ GL G DL+ K+LD++G KL+YR YGE +FDVL A Sbjct: 2 EKEKHHPLGFRDAIISGLNDLNDKGYDLEQVAKFLDTSGGKLNYRLYGEFLFDVLFAA-- 59 Query: 280 LLPGGSVSMDGESP---KTNTCIFSANEDMDTMRNFEQVFVKLMRRYKYLEKMFEEEMKK 450 PGGS+ DG +P KTN CIF AN D +T+R Q+ KL+ RY+YL+K +E+EM K Sbjct: 60 --PGGSIVEDGPNPSTYKTNICIFEANNDNETLRKHVQMHNKLICRYRYLQKSYEDEMNK 117 Query: 451 VLVYLKGFDPEQRIKLARMTALWIGNG 531 +L++LKGF E+R KLA T + + NG Sbjct: 118 ILLFLKGFTDEEREKLAFTTGVVLANG 144 >SB_42832| Best HMM Match : ShTK (HMM E-Value=4.6e-07) Length = 500 Score = 31.5 bits (68), Expect = 0.62 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = -2 Query: 541 EARIRYRSTVQSCAPA*CAVRDRSLSSRPEPFSFPLRTFFPSTCT---DASVSRIPVRNF 371 E R + + S P C + RS+S P+P+ +P+ T +P T +VS+ VR + Sbjct: 156 EGYCRTDAEINSRCPYSCR-KYRSVSPAPQPYPYPIGTLYPYQPTPVPGVTVSQPKVRGW 214 Query: 370 AW 365 W Sbjct: 215 QW 216 >SB_51904| Best HMM Match : CH (HMM E-Value=0.0058) Length = 1187 Score = 30.7 bits (66), Expect = 1.1 Identities = 30/116 (25%), Positives = 48/116 (41%), Gaps = 8/116 (6%) Frame = +1 Query: 7 KRLLHNLLISIYCMSQKVEKP-VLSGQRIKTRKRDEKEKYDPNGFRDALVQ-------GL 162 K+L+ L S+Y + Q + P QR+K R + E + + L Q L Sbjct: 484 KKLIMMYLTSLYDVLQSLTPPKTRKEQRLKLRMQLEAYRIAHSEVTLYLTQVETIVSAKL 543 Query: 163 ERAGGDLDAAYKYLDSAGSKLDYRRYGEVIFDVLIAGGLLLPGGSVSMDGESPKTN 330 + G D +Y ++ D + + DV+ G L+ GG +S ES TN Sbjct: 544 DSLGSQGDPTEEYREAKDLIRDILNHKPDVVDVITKGNELIDGGKISSADESEITN 599 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 478 PEQRIKLARMTALWIGNGCVPPSVLLVLVN 567 PE++ ++ ++ LW NG PP V+ L+N Sbjct: 92 PEEQGRIVKVLNLWQKNGIFPPEVIQPLIN 121 >SB_23284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 219 KTRLPTLWRSHIRCTHCWRPAAAG 290 + RLP WRS R H W+P+ G Sbjct: 19 RDRLPFQWRSRARRNHGWKPSLKG 42 >SB_59343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 864 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 438 LFEHFFQVLVPTHQFHEYLFEISHGVHILIGGEDAG 331 +F H VPT QF++Y EIS + I +GG G Sbjct: 140 VFAHIISTEVPTVQFNQYWVEISDAL-ISLGGVSQG 174 >SB_57496| Best HMM Match : TSP_1 (HMM E-Value=3.2e-13) Length = 609 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +2 Query: 86 GSRPEKEMRKRSMTRTVSATLWYRVWSGPVAISTQPTST*TRP--DQNSTT 232 G + KE +K TV T + P AIS+QPT +P D+N T Sbjct: 40 GGQYSKEQQKAGQDNTVDMTQQHDRMGDPDAISSQPTEDTVKPMADKNRPT 90 >SB_44951| Best HMM Match : TSP_1 (HMM E-Value=3.2e-13) Length = 366 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +2 Query: 86 GSRPEKEMRKRSMTRTVSATLWYRVWSGPVAISTQPTST*TRP--DQNSTT 232 G + KE +K TV T + P AIS+QPT +P D+N T Sbjct: 40 GGQYSKEQQKAGQDNTVDMTQQHDRMGDPDAISSQPTEDTVKPMADKNRPT 90 >SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 5/35 (14%) Frame = +1 Query: 79 GQRIKTRKRDEK-----EKYDPNGFRDALVQGLER 168 G++ K RK DEK +K+DP+G LV+ LER Sbjct: 204 GEKDKGRKSDEKSEDGEKKFDPSGCDKDLVEALER 238 >SB_40901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = -3 Query: 648 GDAALLLDDREHFQHEVQRQVVLQQMFVHQDQQH 547 G+ A+ ++ E F+HEV + ++ + M V ++QH Sbjct: 36 GETAIEAENEEDFEHEVLKFLLYRNMEVSPEEQH 69 >SB_33131| Best HMM Match : DUF1168 (HMM E-Value=1.7e-06) Length = 114 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 345 GEDAGVGLGRFAVHRHRTARQQQAASNEYIEYDFAIASVV 226 G AG G G F H +R R+++ EYIE ASV+ Sbjct: 69 GSSAGAGSGEF--HVYRATRRREYNRQEYIEKKSKEASVI 106 >SB_16907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 886 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -1 Query: 323 LGDSPSIDTEPPGSSRPPAMSTSNMTSP*RR*SSFDPAES 204 L D+P+ + PP S+ P A ST M+S F PA + Sbjct: 162 LWDAPTPTSAPPASAPPKAQSTQGMSSGTSEQPWFSPANT 201 >SB_7955| Best HMM Match : SH3_1 (HMM E-Value=0.77) Length = 1002 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 537 ASIRAAGPGERTSAEGQPGAGLRAGSVRDHQ 629 A +AA GE AEG PG LR G ++Q Sbjct: 33 ARAKAASFGEGDKAEGAPGGELRYGGAAEYQ 63 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 50 VRR*KNQYYRVNGSRPEKEMRKRSMTRTVSATLWYRVWSGP 172 V R K + RV + + R+R + LWYR WS P Sbjct: 560 VEREKREKERVQKKLEKDKERERQREQKRKEALWYREWSRP 600 >SB_56651| Best HMM Match : DUF496 (HMM E-Value=8.5) Length = 114 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 438 LFEHFFQVLVPTHQFHEYLFEISHGVHILIGGEDAG 331 +F H VPT QF++Y EIS + I +GG G Sbjct: 11 VFAHIKSTEVPTVQFNQYWVEISDAL-ISLGGVSQG 45 >SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2480 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 438 LFEHFFQVLVPTHQFHEYLFEISHGVHILIGGEDAG 331 +F H VPT QF++Y EIS + I +GG G Sbjct: 1227 VFAHIKSTEVPTVQFNQYWVEISDAL-ISLGGVSQG 1261 >SB_10566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1264 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 438 LFEHFFQVLVPTHQFHEYLFEISHGVHILIGGEDAG 331 +F H VPT QF++Y EIS + I +GG G Sbjct: 133 VFAHIKSTEVPTVQFNQYWVEISDAL-ISLGGVSQG 167 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -1 Query: 395 FTNTCSKFRMVSISSLAEKMQVLVLGDSPSIDTEPPGSSRPPA 267 + + S+ R +++++ ++QV PSI ++PP PPA Sbjct: 127 YQRSTSQDRHIAMTTRKAQVQVSASSSGPSIASQPPQPPAPPA 169 >SB_40530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 438 LFEHFFQVLVPTHQFHEYLFEISHGVHILIGGEDAG 331 +F H VPT QF++Y EIS + I +GG G Sbjct: 131 VFAHIKSTEVPTVQFNQYWVEISDAL-ISLGGVSQG 165 >SB_39891| Best HMM Match : Seryl_tRNA_N (HMM E-Value=0.11) Length = 285 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 438 LFEHFFQVLVPTHQFHEYLFEISHGVHILIGGEDAG 331 +F H VPT QF++Y EIS + I +GG G Sbjct: 133 VFAHIKSTEVPTVQFNQYWVEISDAL-ISLGGVSQG 167 >SB_2798| Best HMM Match : DNA_pol_B_2 (HMM E-Value=7.9e-10) Length = 1378 Score = 28.3 bits (60), Expect = 5.8 Identities = 23/80 (28%), Positives = 34/80 (42%), Gaps = 6/80 (7%) Frame = +3 Query: 288 GRFGVDGRRIAQDQH-----LHLLRQ*GYGHHAKFRTGIRETDASVQV-LGKNVRRGNEK 449 G GV +R +D + ++ LRQ K RT + D V + L N+ E Sbjct: 92 GSGGVKRKRDPEDDNGKEDVVYELRQTSTKRSTKMRTDCTDYDLKVDLPLRDNLEEALED 151 Query: 450 GSGLLERLRSRTAHQAGAHD 509 G+L+R+ T H HD Sbjct: 152 VEGVLDRVLDDTLHGVQEHD 171 >SB_4026| Best HMM Match : MSSP (HMM E-Value=1.3) Length = 109 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +1 Query: 352 EDMDTMRNFEQVFVKLMRRYKYLEKMFEEEMKKV 453 +DM MR Q++ K MRR + L +M ++M+++ Sbjct: 68 KDMRRMRGLHQMWAKDMRRMRSLPQMRAKDMRRM 101 >SB_9776| Best HMM Match : 7tm_1 (HMM E-Value=8.2e-08) Length = 409 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -2 Query: 205 LGTCRLRRDRHRPAPDPVPERRGNRSGHTSLSHLFFWS*S-VDPIILVF 62 L C + RDR+ P+ R + HT++ +F W S V +I ++ Sbjct: 26 LSLCAITRDRYLAVTSPLQYLRRMPNAHTAVQIVFCWVTSLVSAVITIY 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,101,852 Number of Sequences: 59808 Number of extensions: 511066 Number of successful extensions: 1792 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1760 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -