BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0169 (722 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0254 + 11089236-11089290,11089366-11089415,11089530-110895... 29 4.9 10_08_0186 - 15582925-15584334 28 8.6 >05_03_0254 + 11089236-11089290,11089366-11089415,11089530-11089562, 11090601-11091674,11092245-11092728,11092857-11092882, 11092883-11092993,11093082-11093171,11093251-11093322, 11094043-11094153,11095086-11095143,11095605-11095804, 11096666-11096818,11097134-11097334 Length = 905 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -3 Query: 621 LDLIPGQTLLTMCPVAIIKQKKSSNNLKQRDLPDQLPRVLCG 496 +DL P Q +T C V + ++KK K RDL L R++ G Sbjct: 208 IDLKPLQDAITNCNVLLTERKKV--EFKSRDLVQDLGRIIRG 247 >10_08_0186 - 15582925-15584334 Length = 469 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 187 PKKMSASSATRCSRQHRPGAQLLEHHR*QEQFQHRT 294 P S ++A HR A HHR + +F H T Sbjct: 9 PHPASTTAAAAARHHHRRNAPFAPHHRRRRRFAHLT 44 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,913,650 Number of Sequences: 37544 Number of extensions: 301488 Number of successful extensions: 546 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -