BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0169 (722 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48804-1|CAA88742.1| 424|Homo sapiens OA1 protein. 30 9.6 BC068977-1|AAH68977.1| 424|Homo sapiens G protein-coupled recep... 30 9.6 >Z48804-1|CAA88742.1| 424|Homo sapiens OA1 protein. Length = 424 Score = 29.9 bits (64), Expect = 9.6 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = +1 Query: 418 YICCFWWYLLSC*LRYNVIKTKCGINTT*YPGKLIW*IPLLEIIAGFLLFY 570 Y CFWW Y VI+ G++T + W + L + G + Y Sbjct: 147 YSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLY 197 >BC068977-1|AAH68977.1| 424|Homo sapiens G protein-coupled receptor 143 protein. Length = 424 Score = 29.9 bits (64), Expect = 9.6 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = +1 Query: 418 YICCFWWYLLSC*LRYNVIKTKCGINTT*YPGKLIW*IPLLEIIAGFLLFY 570 Y CFWW Y VI+ G++T + W + L + G + Y Sbjct: 147 YSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLY 197 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,209,356 Number of Sequences: 237096 Number of extensions: 1719130 Number of successful extensions: 7050 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7050 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -