BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0164 (641 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 28 1.3 SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyce... 28 1.3 SPAC12G12.14c |pfs2||WD repeat protein Pfs2|Schizosaccharomyces ... 27 2.3 SPCC794.11c |||ENTH domain protein Ent3|Schizosaccharomyces pomb... 27 3.0 SPCC830.08c |||Golgi membrane protein |Schizosaccharomyces pombe... 26 4.0 SPAC630.14c |tup12||transcriptional corepressor Tup12 |Schizosac... 26 5.3 SPBC359.04c |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Ma... 25 7.0 SPAC18B11.10 |tup11||transcriptional corepressor Tup11|Schizosac... 25 9.3 SPAC25H1.08c |||ribosome biogenesis protein Sqt1|Schizosaccharom... 25 9.3 >SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 27.9 bits (59), Expect = 1.3 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 537 SLQSLRTAGGHWQCRCQYQDFRCGRGCSRNQLP 635 S S+ T G W C C + +FR C R P Sbjct: 553 SRPSVTTDQGDWLCECGFTNFRRRSNCLRCNAP 585 >SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2310 Score = 27.9 bits (59), Expect = 1.3 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 6/72 (8%) Frame = +1 Query: 97 TSNQSCFQNLNII*---NYSRFITILIKMKEDNVDIDTKNVVKNRELLYRMIIS---QLY 258 T+ QSC + II N+S + +K++ D V +N+ EL+Y + S Q+ Sbjct: 1794 TAKQSCTSLVQIIDDLLNFSELKSGKMKLEPDKVFDVEENIADCIELVYPSLSSKPVQIS 1853 Query: 259 YDGYQPIAATLA 294 YD Y + A LA Sbjct: 1854 YDIYPNVPALLA 1865 >SPAC12G12.14c |pfs2||WD repeat protein Pfs2|Schizosaccharomyces pombe|chr 1|||Manual Length = 509 Score = 27.1 bits (57), Expect = 2.3 Identities = 16/54 (29%), Positives = 22/54 (40%) Frame = +1 Query: 478 EPATYETAYVTSHKMSCRAGAFSHCGQLVATGSVDASIKILDVGEDAREISSRG 639 EP V +H+M R AFS T S D S+K+ + E+ G Sbjct: 151 EPNLNNVKIVQAHEMEVRDVAFSPNDSKFVTASDDGSLKVWNFHMSTEELKLTG 204 >SPCC794.11c |||ENTH domain protein Ent3|Schizosaccharomyces pombe|chr 3|||Manual Length = 476 Score = 26.6 bits (56), Expect = 3.0 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +1 Query: 394 AASNAAEHLLGTTGFDLEYEMDASSLA--PEPATYETAYVTSHKMS 525 A++ AA + GF+ ++ SS A P+P T+ T Y ++ MS Sbjct: 356 ASNTAAFSSISFGGFNSLNQLPTSSSAFTPQPTTFNTGYTSAFGMS 401 >SPCC830.08c |||Golgi membrane protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 182 Score = 26.2 bits (55), Expect = 4.0 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -2 Query: 460 RPFRTPSQNRLCPKDARQHSMQPAYLSCLAH--AVD-PPS 350 RP+ TP R+C +RQ++ S AH A D PPS Sbjct: 142 RPYITPHVIRICKSVSRQNAAPAPTASSFAHTTATDIPPS 181 >SPAC630.14c |tup12||transcriptional corepressor Tup12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 586 Score = 25.8 bits (54), Expect = 5.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 529 RAGAFSHCGQLVATGSVDASIKILDVGE 612 R+ AFS G+ +ATG D I+I D+ + Sbjct: 338 RSVAFSPDGKYLATGVEDQQIRIWDIAQ 365 >SPBC359.04c |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual Length = 358 Score = 25.4 bits (53), Expect = 7.0 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -1 Query: 617 ASSPTSKILILASTLPVATSCPQ*LKAPARQDILCEVT 504 AS PTS ++ ST+P + P P IL T Sbjct: 101 ASVPTSSSILSNSTIPTTSPVPTTSSTPTSSSILSNST 138 >SPAC18B11.10 |tup11||transcriptional corepressor Tup11|Schizosaccharomyces pombe|chr 1|||Manual Length = 614 Score = 25.0 bits (52), Expect = 9.3 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 1/96 (1%) Frame = +1 Query: 322 PPSDRLLNVMMVGLQHEPDRKDRLAASNAAEHLLGTTGFDLEYEM-DASSLAPEPATYET 498 P R+ N+ +V P + SN ++L TG + + D + +E Sbjct: 296 PACKRVFNINLVHTLEHPSVVCCVKFSNNGKYL--ATGCNQAANVFDVQTGKKLFTLHEE 353 Query: 499 AYVTSHKMSCRAGAFSHCGQLVATGSVDASIKILDV 606 + S + R AFS G+ + TG+ D IK+ D+ Sbjct: 354 SPDPSRDLYVRTIAFSPDGKYLVTGTEDRQIKLWDL 389 >SPAC25H1.08c |||ribosome biogenesis protein Sqt1|Schizosaccharomyces pombe|chr 1|||Manual Length = 399 Score = 25.0 bits (52), Expect = 9.3 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 505 VTSHKMSCRAGAFSHCGQLVATGSVDASIKI 597 +T HK S A +S G +ATG +D+ +++ Sbjct: 100 LTGHKDSIVAIDWSFDGTYIATGGMDSQVRL 130 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,553,749 Number of Sequences: 5004 Number of extensions: 51827 Number of successful extensions: 152 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -