BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0163 (504 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0528 + 21782567-21782651,21783355-21783563,21784095-217842... 28 4.9 02_05_0232 + 27041793-27042087,27042822-27042943,27043098-270432... 28 4.9 07_03_1567 - 27772815-27773302,27773471-27773561,27773641-277739... 27 6.5 06_03_0810 - 24817268-24817350,24817547-24817697,24818441-248185... 27 6.5 09_04_0297 - 16471315-16471485,16471948-16472013,16473466-164736... 27 8.6 07_03_1542 + 27577257-27577559,27577653-27577730,27577900-275779... 27 8.6 >06_03_0528 + 21782567-21782651,21783355-21783563,21784095-21784232, 21784520-21784734,21784813-21784967,21785010-21785071, 21785832-21785834 Length = 288 Score = 27.9 bits (59), Expect = 4.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 306 FEPRQSINTVSLSSERNFARSH 241 F +++N + LSSERN++R H Sbjct: 27 FTGLKAVNKIGLSSERNYSRGH 48 >02_05_0232 + 27041793-27042087,27042822-27042943,27043098-27043219, 27043601-27043705,27043828-27044257,27044356-27044517, 27044565-27045260,27045349-27046128,27046441-27046654, 27047621-27047981,27047993-27048140,27048276-27048419, 27048784-27048888,27049749-27049794,27050089-27050255, 27050338-27050490,27050654-27050950,27051053-27051220, 27051298-27051363,27051451-27051927,27052031-27052768, 27052935-27053120 Length = 1993 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 232 VERMAPCKVTFRRKRHRIDRLSGLKRVFCIAHPFRCEL 345 +ER+ K T RR++ + LS LK+V + H + EL Sbjct: 1502 LERLDSSKETKRRRKAESEMLSALKKVHDLEHQYLNEL 1539 >07_03_1567 - 27772815-27773302,27773471-27773561,27773641-27773988, 27774929-27775110,27775191-27775368,27775453-27775605, 27775993-27776232,27776369-27776449,27776485-27776730, 27777151-27777240,27777536-27777778,27778365-27778529, 27779017-27779080,27779162-27779286,27779383-27779476, 27779647-27779714,27779798-27779989,27780618-27780752, 27780847-27780934,27781014-27781107,27781484-27781547, 27781657-27781708,27781911-27782014,27782099-27782158, 27782687-27782770,27782892-27783125,27783442-27783864, 27784675-27784736,27784867-27785521 Length = 1700 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 110 SRLHVGIDATGYSKW*KVRVNRRKQCTIKM 199 +RL VGI GY W K+R++ + T K+ Sbjct: 1335 ARLMVGIHWYGYGNWEKIRLDPKLSLTAKI 1364 >06_03_0810 - 24817268-24817350,24817547-24817697,24818441-24818542, 24818722-24818802,24818900-24819020,24819284-24819401, 24819514-24819637,24819898-24819963,24820117-24820407, 24820455-24820592,24820967-24821116,24821240-24821410, 24821543-24821746,24821880-24822104,24822461-24822595, 24822995-24823096,24823586-24823882,24823979-24824167, 24824581-24824628,24824872-24825070,24825501-24825730, 24826373-24826568,24826695-24826882 Length = 1202 Score = 27.5 bits (58), Expect = 6.5 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 429 AFNSLHCTVDDNSIFPAAN 373 AF LH +++NS+FP AN Sbjct: 815 AFQLLHMVLEENSVFPNAN 833 >09_04_0297 - 16471315-16471485,16471948-16472013,16473466-16473628, 16473847-16473956 Length = 169 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 211 RMRMRPGVERMAPCKVTFRRKRHR 282 +MRMR G+ RM+ + RR+RHR Sbjct: 20 QMRMRSGLFRMSEMVQSRRRRRHR 43 >07_03_1542 + 27577257-27577559,27577653-27577730,27577900-27577999, 27578677-27578819,27579242-27579478 Length = 286 Score = 27.1 bits (57), Expect = 8.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 63 FLNKCVFVNFVYIHYYRGCM 122 FLN CV++ Y Y+ GC+ Sbjct: 125 FLNGCVYIKEAYSVYWSGCL 144 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,766,697 Number of Sequences: 37544 Number of extensions: 251271 Number of successful extensions: 669 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -