BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0161 (714 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 25 0.94 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 25 0.94 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 25 0.94 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 2.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.2 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 23 2.2 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 6.6 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 6.6 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 24.6 bits (51), Expect = 0.94 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 392 GFVLKHNRSDSAHRTSKHVYTSNP 321 G ++ HN DS HR + + + +P Sbjct: 212 GLIVYHNSDDSFHRLTSNTFDYDP 235 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 24.6 bits (51), Expect = 0.94 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 392 GFVLKHNRSDSAHRTSKHVYTSNP 321 G ++ HN DS HR + + + +P Sbjct: 212 GLIVYHNSDDSFHRLTSNTFDYDP 235 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 24.6 bits (51), Expect = 0.94 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 392 GFVLKHNRSDSAHRTSKHVYTSNP 321 G ++ HN DS HR + + + +P Sbjct: 212 GLIVYHNSDDSFHRLTSNTFDYDP 235 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 525 YESAVLQHRNI*DFNANHIP 584 +ES Q++NI + +A HIP Sbjct: 409 FESVTSQYKNIREDDARHIP 428 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 2.2 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 610 ALSYEDVVWIPCSVNPLCHPTVKALMVDHINHYI 711 AL Y WI S HP KA + D I + I Sbjct: 185 ALGYLKDAWIGRSFIDYVHPKDKATLADQIKNGI 218 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 23.4 bits (48), Expect = 2.2 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 610 ALSYEDVVWIPCSVNPLCHPTVKALMVDHINHYI 711 AL Y WI S HP KA + D I + I Sbjct: 180 ALGYLKDAWIGRSFIDYVHPKDKATLADQIKNGI 213 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -2 Query: 386 VLKHNRSDSAHRTSKHVYTSN 324 ++ N DS HR S H N Sbjct: 212 IIYQNADDSFHRLSSHTLNHN 232 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 55 NLIPSDKCYTWDV 93 NL+P CYT DV Sbjct: 364 NLLPPGVCYTCDV 376 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,237 Number of Sequences: 438 Number of extensions: 3817 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -