BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0157 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 27 0.25 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 4.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 7.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 7.1 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 9.3 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 26.6 bits (56), Expect = 0.25 Identities = 11/48 (22%), Positives = 18/48 (37%) Frame = +3 Query: 312 NQHRGASSPGNMSGAHSDINSPENSMPGSPLGPKSPSTPKSSDVGSNP 455 +Q + +PG H +P+ P +P P P + NP Sbjct: 13 SQQPSSGAPGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPPGAPPSQNP 60 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 529 VLVGPQSLLLVPQILDLDQHHQIHSHN 609 VL GP S P +++ HHQ+H+ + Sbjct: 154 VLDGPDS----PPLVESQMHHQMHTQH 176 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 7.1 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 324 GASSPGNMSGAHSDINSPENSMPGSPLGPKSPSTPKSSDVGSNPGS 461 G G + + + I S S PG SPS+P S +P S Sbjct: 62 GGVELGWFNDSAAAITSTSPSYPGGGSSSPSPSSPSSFFSSVSPTS 107 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 384 SMPGSPLGPKSPSTPKSSDVGSNPGS 461 S PGS P SP+ SDV S+ S Sbjct: 234 STPGSGSLPASPADSGVSDVESSTSS 259 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 451 LEPTSLDLGVLGDLGPKGDPGIEFSGELISE 359 ++PT++ L ++ K GIE +IS+ Sbjct: 110 IKPTAIGLSLIKGFDKKQGGGIELISHIISK 140 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,708 Number of Sequences: 438 Number of extensions: 2788 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -