BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0154 (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40580.2 68418.m04925 20S proteasome beta subunit B (PBB2) (P... 28 5.1 At5g40580.1 68418.m04924 20S proteasome beta subunit B (PBB2) (P... 28 5.1 At3g55220.1 68416.m06133 splicing factor, putative contains CPSF... 28 5.1 At3g55200.1 68416.m06131 splicing factor, putative contains CPSF... 28 5.1 At3g27430.2 68416.m03429 20S proteasome beta subunit B (PBB1) id... 28 6.8 At3g27430.1 68416.m03428 20S proteasome beta subunit B (PBB1) id... 28 6.8 At3g63220.2 68416.m07103 kelch repeat-containing F-box family pr... 27 9.0 At3g63220.1 68416.m07102 kelch repeat-containing F-box family pr... 27 9.0 At3g27490.1 68416.m03437 DC1 domain-containing protein contains ... 27 9.0 >At5g40580.2 68418.m04925 20S proteasome beta subunit B (PBB2) (PRCFC) identical to 20S proteasome beta subunit PBB2 [Arabidopsis thaliana] GI:3421104, cDNA proteasome subunit prcfc GI:2511575 Length = 274 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 16 LLPFLLTCAIASAAECENATSLSLMIDSLLATYDRESPPDSKIVVNLTLHLRH 174 + P + C +AA+ E T M+ S L + ++ DS++V LTL +H Sbjct: 76 MAPNIYCCGAGTAADTEAVTD---MVSSQLRLHRYQTGRDSRVVTALTLLKKH 125 >At5g40580.1 68418.m04924 20S proteasome beta subunit B (PBB2) (PRCFC) identical to 20S proteasome beta subunit PBB2 [Arabidopsis thaliana] GI:3421104, cDNA proteasome subunit prcfc GI:2511575 Length = 274 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 16 LLPFLLTCAIASAAECENATSLSLMIDSLLATYDRESPPDSKIVVNLTLHLRH 174 + P + C +AA+ E T M+ S L + ++ DS++V LTL +H Sbjct: 76 MAPNIYCCGAGTAADTEAVTD---MVSSQLRLHRYQTGRDSRVVTALTLLKKH 125 >At3g55220.1 68416.m06133 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 373 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 284 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At3g55200.1 68416.m06131 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 373 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 284 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At3g27430.2 68416.m03429 20S proteasome beta subunit B (PBB1) identical to 20S proteasome beta subunit PBB1 (PBB1) GB:AAC32066 [Arabidopsis thaliana] (Genetics 149 (2), 677-692 (1998)); contains Pfam profile: PF00227 proteasome A-type and B-type; Length = 273 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +1 Query: 16 LLPFLLTCAIASAAECENATSLSLMIDSLLATYDRESPPDSKIVVNLTLHLRH 174 + P + C +AA+ E T M+ S L + ++ DS+++ LTL +H Sbjct: 76 MAPNIYCCGAGTAADTEAVTD---MVSSQLRLHRYQTGRDSRVITALTLLKKH 125 >At3g27430.1 68416.m03428 20S proteasome beta subunit B (PBB1) identical to 20S proteasome beta subunit PBB1 (PBB1) GB:AAC32066 [Arabidopsis thaliana] (Genetics 149 (2), 677-692 (1998)); contains Pfam profile: PF00227 proteasome A-type and B-type; Length = 267 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +1 Query: 16 LLPFLLTCAIASAAECENATSLSLMIDSLLATYDRESPPDSKIVVNLTLHLRH 174 + P + C +AA+ E T M+ S L + ++ DS+++ LTL +H Sbjct: 76 MAPNIYCCGAGTAADTEAVTD---MVSSQLRLHRYQTGRDSRVITALTLLKKH 125 >At3g63220.2 68416.m07103 kelch repeat-containing F-box family protein contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 352 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 136 SKIVVNLTLHLRHANIRESESTVRILADLQMNWIDKRLSWNAG 264 S +VVN +H+ H + STV++L +++ W K W G Sbjct: 210 SGLVVNGKVHVLHKGL----STVQVLESVKLGWDVKDYGWPQG 248 >At3g63220.1 68416.m07102 kelch repeat-containing F-box family protein contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 345 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 136 SKIVVNLTLHLRHANIRESESTVRILADLQMNWIDKRLSWNAG 264 S +VVN +H+ H + STV++L +++ W K W G Sbjct: 203 SGLVVNGKVHVLHKGL----STVQVLESVKLGWDVKDYGWPQG 241 >At3g27490.1 68416.m03437 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 682 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = -1 Query: 671 CAGARLRKDIWNIATRASTSPRSWLCTALDRSVTSH 564 C G + W T+P +W T L+ VT H Sbjct: 552 CYGEKASGKYWCDICERETNPETWFYTGLESGVTLH 587 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,377,547 Number of Sequences: 28952 Number of extensions: 370425 Number of successful extensions: 1179 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1175 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -