BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0146 (741 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060471-1|AAL25510.1| 323|Drosophila melanogaster SD05789p pro... 44 3e-04 AE014296-638|AAN11559.1| 323|Drosophila melanogaster CG12016-PB... 44 3e-04 AE014296-637|AAF47759.2| 323|Drosophila melanogaster CG12016-PA... 44 3e-04 BT022821-1|AAY55237.1| 545|Drosophila melanogaster IP13241p pro... 32 0.94 AE014296-1022|AAF50737.1| 564|Drosophila melanogaster CG18586-P... 32 0.94 >AY060471-1|AAL25510.1| 323|Drosophila melanogaster SD05789p protein. Length = 323 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = +3 Query: 603 WIIIGISGVTCGGKTTLANKL 665 W++IGISGVTCGGKTTLA+ L Sbjct: 4 WLVIGISGVTCGGKTTLAHSL 24 >AE014296-638|AAN11559.1| 323|Drosophila melanogaster CG12016-PB, isoform B protein. Length = 323 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = +3 Query: 603 WIIIGISGVTCGGKTTLANKL 665 W++IGISGVTCGGKTTLA+ L Sbjct: 4 WLVIGISGVTCGGKTTLAHSL 24 >AE014296-637|AAF47759.2| 323|Drosophila melanogaster CG12016-PA, isoform A protein. Length = 323 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = +3 Query: 603 WIIIGISGVTCGGKTTLANKL 665 W++IGISGVTCGGKTTLA+ L Sbjct: 4 WLVIGISGVTCGGKTTLAHSL 24 >BT022821-1|AAY55237.1| 545|Drosophila melanogaster IP13241p protein. Length = 545 Score = 31.9 bits (69), Expect = 0.94 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 689 VDWC*GIL*LIGEGRFSATSDPGNADYDP-IFARHI 585 +DWC G+ I G FS TS + D+DP +F R I Sbjct: 241 LDWCSGLSMAITSGVFSTTSIIADCDFDPGLFCRAI 276 >AE014296-1022|AAF50737.1| 564|Drosophila melanogaster CG18586-PA protein. Length = 564 Score = 31.9 bits (69), Expect = 0.94 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 689 VDWC*GIL*LIGEGRFSATSDPGNADYDP-IFARHI 585 +DWC G+ I G FS TS + D+DP +F R I Sbjct: 260 LDWCSGLSMAITSGVFSTTSIIADCDFDPGLFCRAI 295 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,166,948 Number of Sequences: 53049 Number of extensions: 669072 Number of successful extensions: 1549 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1549 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3355404063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -