BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0146 (741 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33520.3 68417.m04762 metal-transporting P-type ATPase, putat... 33 0.26 At4g33520.2 68417.m04761 metal-transporting P-type ATPase, putat... 33 0.26 At4g33520.1 68417.m04760 metal-transporting P-type ATPase, putat... 33 0.26 At3g27440.1 68416.m03430 uracil phosphoribosyltransferase, putat... 33 0.26 At1g26190.1 68414.m03196 phosphoribulokinase/uridine kinase fami... 31 1.1 At3g07980.1 68416.m00975 protein kinase, putative similar to MAP... 30 1.9 At2g40250.1 68415.m04950 GDSL-motif lipase/hydrolase family prot... 29 3.2 At1g73980.1 68414.m08568 phosphoribulokinase/uridine kinase fami... 29 3.2 At5g40870.1 68418.m04963 uracil phosphoribosyltransferase, putat... 29 4.3 At3g52310.1 68416.m05749 ABC transporter family protein contains... 29 4.3 At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 29 4.3 At2g01460.1 68415.m00069 phosphoribulokinase/uridine kinase fami... 29 4.3 At3g11964.1 68416.m01479 S1 RNA-binding domain-containing protei... 28 5.7 At5g04720.1 68418.m00482 disease resistance protein (CC-NBS-LRR ... 28 7.5 At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR... 28 7.5 At5g65290.1 68418.m08212 LMBR1 integral membrane family protein ... 27 9.9 At1g04160.1 68414.m00406 myosin family protein contains Pfam pro... 27 9.9 >At4g33520.3 68417.m04762 metal-transporting P-type ATPase, putative (PAA1) nearly identical to gi:2668492; contains Pfam heavy-metal-associated domain PF00403 Length = 949 Score = 32.7 bits (71), Expect = 0.26 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 564 ANLSQNSNMPGKDWIIIGISGVTCGGKTTLANKL 665 AN S ++P D II+ + G+TCGG + K+ Sbjct: 136 ANASDGVSVPSSDIIILDVGGMTCGGCSASVKKI 169 >At4g33520.2 68417.m04761 metal-transporting P-type ATPase, putative (PAA1) nearly identical to gi:2668492; contains Pfam heavy-metal-associated domain PF00403 Length = 949 Score = 32.7 bits (71), Expect = 0.26 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 564 ANLSQNSNMPGKDWIIIGISGVTCGGKTTLANKL 665 AN S ++P D II+ + G+TCGG + K+ Sbjct: 136 ANASDGVSVPSSDIIILDVGGMTCGGCSASVKKI 169 >At4g33520.1 68417.m04760 metal-transporting P-type ATPase, putative (PAA1) nearly identical to gi:2668492; contains Pfam heavy-metal-associated domain PF00403 Length = 237 Score = 32.7 bits (71), Expect = 0.26 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 564 ANLSQNSNMPGKDWIIIGISGVTCGGKTTLANKL 665 AN S ++P D II+ + G+TCGG + K+ Sbjct: 136 ANASDGVSVPSSDIIILDVGGMTCGGCSASVKKI 169 >At3g27440.1 68416.m03430 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 465 Score = 32.7 bits (71), Expect = 0.26 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = +3 Query: 570 LSQNSNMPGKDWIIIGISGVTCGGKTTLANKLKNAL--TPVYVFHQDKYFY 716 +S ++ P K +IG++G T GKTT+ N + + L V + +QD +++ Sbjct: 18 VSPSAPAPLKQPFVIGVAGGTASGKTTVCNMIMSQLHDQRVVLVNQDSFYH 68 >At1g26190.1 68414.m03196 phosphoribulokinase/uridine kinase family protein weak similarity to SP|Q59190 Uridine kinase (EC 2.7.1.48) (Uridine monophosphokinase) (Cytidine monophosphokinase) {Borrelia burgdorferi}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 674 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 606 IIIGISGVTCGGKTTLANKLKNALTPVYVFHQDKY 710 I++G++G + GKT K+ N L V V D Y Sbjct: 66 ILVGVAGPSGAGKTVFTEKILNFLPSVAVISMDNY 100 >At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1367 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 268 IKKLLVLSEPAADPNIVEKIIQRAKKQKPLLENTEVKKDSAVYEL 402 +K L + + DPN +E + QRA K L+ N E+K+ VY++ Sbjct: 1090 LKILECTNHLSTDPNCLENL-QRADAIKQLIPNLELKEGPLVYQI 1133 >At2g40250.1 68415.m04950 GDSL-motif lipase/hydrolase family protein similar to family II lipases EXL3 GI:15054386, EXL1 GI:15054382, EXL2 GI:15054384 from [Arabidopsis thaliana]; contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase Length = 361 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -3 Query: 499 KGKCGTG*RTLGPL*RTVPKQRRIVETTLDLGSIHKQQNLFSLLCS 362 +G CGTG GPL + + + V L S+H Q +S++ S Sbjct: 306 RGCCGTGLLEAGPLCQPLSRTCDDVSKYLFFDSVHPSQTAYSVIAS 351 >At1g73980.1 68414.m08568 phosphoribulokinase/uridine kinase family protein weak similarity to SP|Q59190 Uridine kinase (EC 2.7.1.48) (Uridine monophosphokinase) (Cytidine monophosphokinase) {Borrelia burgdorferi}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 643 Score = 29.1 bits (62), Expect = 3.2 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 606 IIIGISGVTCGGKTTLANKLKNALTPVYVFHQDKY 710 I++G++G + GKT K+ N + + + + D Y Sbjct: 66 ILVGLAGPSGAGKTIFTEKILNFMPSIAIINMDNY 100 >At5g40870.1 68418.m04963 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 486 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +3 Query: 552 VPPSANLSQNSNMPGKDWIIIGISGVTCGGKTTLANKLKNALTP--VYVFHQDKYF 713 V S+ S + P K IIG+SG T GKTT+ + + L V + +QD ++ Sbjct: 46 VSSSSPSSSDPEAP-KQPFIIGVSGGTASGKTTVCDMIIQQLHDHRVVLVNQDSFY 100 >At3g52310.1 68416.m05749 ABC transporter family protein contains Pfam profile: PF00005 ABC transporter Length = 737 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +3 Query: 501 FIDLSHKKSIQYRTTNFVPPSANLSQNSNMPGKDWIIIGISGVTCGGKTTLANKL 665 FID+++K + + T++ N S PG+ ++G SG GKTTL N L Sbjct: 147 FIDITYKVTTKGMTSSSEKSILNGISGSAYPGELLALMGPSG---SGKTTLLNAL 198 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +1 Query: 268 IKKLLVLSEPAADPNIVEKIIQRAKKQKPLLENTEVKKDSAVYEL 402 +K L + + DPN +E + QRA K L+ N E+K VY++ Sbjct: 1090 LKILECTNHLSTDPNCLENL-QRADAIKHLIPNLELKDGHLVYQI 1133 >At2g01460.1 68415.m00069 phosphoribulokinase/uridine kinase family protein contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 723 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 606 IIIGISGVTCGGKTTLANKLKNALTPVYVFHQDKYF 713 +I+GI G + GKT+LA+K+ N + V + YF Sbjct: 521 VIVGIGGPSGSGKTSLAHKMAN-IVGCEVVSLESYF 555 >At3g11964.1 68416.m01479 S1 RNA-binding domain-containing protein similar to SP|Q05022 rRNA biogenesis protein RRP5 {Saccharomyces cerevisiae}; contains Pfam profile PF00575: S1 RNA binding domain Length = 1838 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -3 Query: 232 SFFHFYFCMDEELLDLQTSNVS 167 SF YF MDE++ DLQ+S+++ Sbjct: 748 SFVQEYFLMDEKISDLQSSDIT 769 >At5g04720.1 68418.m00482 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 811 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 609 IIGISGVTCGGKTTLANKL 665 +IGISG++ GKTTLA +L Sbjct: 202 LIGISGMSGSGKTTLAKEL 220 >At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1607 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 609 IIGISGVTCGGKTTLANKLKNALTPVY 689 +IGI G+ GKTT+A +L L P + Sbjct: 291 LIGICGLPGSGKTTIAKRLYQQLLPQF 317 >At5g65290.1 68418.m08212 LMBR1 integral membrane family protein contains Pfam PF04791: LMBR1-like conserved region Length = 733 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 497 LIYRSEPQKINSVSYNKLCSTISKFEPKFKY 589 +IY P++ +SV+ +CS I+++ P Y Sbjct: 418 MIYSLTPRQTSSVNLLMICSMIARYAPPISY 448 >At1g04160.1 68414.m00406 myosin family protein contains Pfam profiles: PF02736 myosin N-terminal SH3-like domain, PF00063 myosin head (motor domain), PF00612 IQ calmodulin-binding motif, PF01843: DIL domain Length = 1500 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +1 Query: 280 LVLSEPAADPNIVEKIIQRAKKQKPLLENTEVKKDSAVYEL 402 ++ P D ++EK+ +K K ++ + E+K D EL Sbjct: 960 IIKEVPVVDQELMEKLTNENEKLKGMVSSLEIKIDETAKEL 1000 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,775,744 Number of Sequences: 28952 Number of extensions: 327476 Number of successful extensions: 919 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 919 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -