BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0142 (322 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 4.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 4.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 4.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 4.2 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 19 9.7 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 19 9.7 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 4.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 184 VKLAATLLSASDSDTPQCAARRAPQSLAPSPH 89 VKL + + SD Q R P P+P+ Sbjct: 637 VKLLVATIDEAASDVHQTHMRIRPPKKIPTPY 668 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 4.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 184 VKLAATLLSASDSDTPQCAARRAPQSLAPSPH 89 VKL + + SD Q R P P+P+ Sbjct: 637 VKLLVATIDEAASDVHQTHMRIRPPKKIPTPY 668 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 4.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 184 VKLAATLLSASDSDTPQCAARRAPQSLAPSPH 89 VKL + + SD Q R P P+P+ Sbjct: 637 VKLLVATIDEAASDVHQTHMRIRPPKKIPTPY 668 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 4.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 184 VKLAATLLSASDSDTPQCAARRAPQSLAPSPH 89 VKL + + SD Q R P P+P+ Sbjct: 637 VKLLVATIDEAASDVHQTHMRIRPPKKIPTPY 668 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 19.4 bits (38), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 35 IGRHPREHGAA 3 + RH R HGAA Sbjct: 121 LNRHMRVHGAA 131 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 19.4 bits (38), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 35 IGRHPREHGAA 3 + RH R HGAA Sbjct: 377 LNRHMRVHGAA 387 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,032 Number of Sequences: 336 Number of extensions: 368 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6048897 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -