BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0140 (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 4.7 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 8.3 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 572 SCQPKFRIEPKDTSIVEKMNDKHSV 646 +CQP +EP TS V + D H V Sbjct: 112 TCQPSIPLEPDFTSDVTE-RDNHLV 135 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 533 KKTLQTNNRTT*RSCQPKFRIEPKDTSIVEKM 628 K L + T SC KF P DT I M Sbjct: 118 KTLLYMSKLTLVLSCAMKFESYPHDTQICSMM 149 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,885 Number of Sequences: 438 Number of extensions: 3982 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -