BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0133 (528 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.2 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 2.2 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 2.9 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 21 8.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.9 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 131 GRDHDRVHEDRRGLYLH 81 G+D VH RRGL LH Sbjct: 14 GQDKHMVHWFRRGLRLH 30 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -3 Query: 472 RQLSKDNSASNGSGDFLAALHTQTNMTVVVANGNK 368 ++ K NS +NGS D + ++ + NG+K Sbjct: 275 KEKDKPNSTTNGSPDVIKVEPELSDSEKTLCNGSK 309 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 22.2 bits (45), Expect = 2.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 508 LVTPVTSSNW*NRQLSKDNSASNGSGD 428 L+ T+S+ R + NSASN SGD Sbjct: 330 LLRHYTASSKNYRSATGGNSASNSSGD 356 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 20.6 bits (41), Expect = 8.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 321 LYRNKHVPDSAHVSRHL 371 L + K PD A + RHL Sbjct: 51 LEKGKCTPDGAELKRHL 67 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 217 VDFSFANKTAEFGDRN 170 VDF F N +A F D N Sbjct: 82 VDFLFDNFSAAFQDHN 97 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 217 VDFSFANKTAEFGDRN 170 VDF F N +A F D N Sbjct: 315 VDFLFDNFSAAFQDHN 330 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 217 VDFSFANKTAEFGDRN 170 VDF F N +A F D N Sbjct: 315 VDFLFDNFSAAFQDHN 330 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,762 Number of Sequences: 336 Number of extensions: 2332 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -