BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0132 (682 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF098992-12|AAC67453.2| 328|Caenorhabditis elegans Hypothetical... 29 3.1 Z68004-7|CAA91988.2| 237|Caenorhabditis elegans Hypothetical pr... 27 9.4 >AF098992-12|AAC67453.2| 328|Caenorhabditis elegans Hypothetical protein F53C3.1 protein. Length = 328 Score = 29.1 bits (62), Expect = 3.1 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -3 Query: 581 HCRVKYHRLKIKMAPSKINMSLLHNIIINITNELQLNKLLCYM-SVQYQ 438 HC+VK LKIK K N + L+ I +LNK+L Y+ S YQ Sbjct: 235 HCKVKNEVLKIKENTRKDNRAALYK---GIPQTSELNKILDYIDSRAYQ 280 >Z68004-7|CAA91988.2| 237|Caenorhabditis elegans Hypothetical protein F47B10.8 protein. Length = 237 Score = 27.5 bits (58), Expect = 9.4 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +1 Query: 628 YNIFWNYAKLVLILILTY 681 YN+ WN+ ++L L+ Y Sbjct: 133 YNVIWNFGMIILFLVFVY 150 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,183,051 Number of Sequences: 27780 Number of extensions: 211358 Number of successful extensions: 377 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -